Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01703
Gene name
Locationscaffold_02:200519..201661
Strand+
Gene length (bp)1142
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 5.5E-25 39 190
PF00494 SQS_PSY Squalene/phytoene synthase 3.2E-14 203 331

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1748 0.0812 0.0365 0.0545 0.864 0.0285 0.0877 0.0538 0.0603 0.0302

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4501
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5320
Ophiocordyceps australis map64 (Brazil) OphauB2|3798
Ophiocordyceps camponoti-floridani Ophcf2|01703 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6337
Ophiocordyceps kimflemingae Ophio5|4294
Ophiocordyceps subramaniannii Hirsu2|9385

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01703
MHRPSLVANGLARLIRGIRSYATDADIASARSYCLTQLQKSHHEAHLIHRFVPPPIQDAYAALRALNMELVRLPE
LVSKPIMGEMRIKFWQDSLDRTFSDDPPREPICVLLGQALRQLENRAGGDASRQSIKFWISRLVRTRQRYMDNRP
FPNLAALEDYAENTYSTLIYATLAFIPLRSTQLDHLASHTPKGASAPSPRTPVLLLPLDVMSSAGVKEEDVFRSG
PRAPGLQDAVFKVATRAHDHLLTAREMLARLTRGEDAGHECEHGVVEDDDVYGGGDDDVREGLRRCFGVFLEAIP
AGVYLDALEKVNFDPWAVGSSGWRLPWRIWRALSKREL*
Coding >Ophcf2|01703
ATGCATCGACCCTCGCTCGTCGCCAATGGTCTCGCAAGGCTCATACGCGGTATTCGAAGCTACGCGACAGACGCC
GACATCGCCTCCGCTCGAAGCTACTGTCTAACCCAACTCCAGAAAAGCCATCATGAAGCACACCTCATCCACCGC
TTCGTCCCCCCCCCCATTCAAGACGCCTACGCCGCCCTCCGCGCCTTGAACATGGAACTCGTCCGCCTTCCGGAG
CTAGTCTCCAAGCCCATCATGGGCGAAATGCGCATCAAGTTCTGGCAAGACTCTCTCGACCGCACCTTTTCCGAC
GATCCGCCCCGCGAACCCATCTGCGTCCTCCTCGGCCAAGCGCTACGCCAACTCGAGAACAGAGCCGGAGGCGAC
GCCTCTAGACAGTCCATCAAGTTCTGGATCTCGCGTCTCGTCAGGACGAGGCAGAGATACATGGACAACCGGCCG
TTTCCGAACCTGGCCGCGTTGGAGGACTACGCGGAAAACACGTACTCGACTCTCATCTACGCCACGCTCGCCTTC
ATCCCCCTCCGGTCTACGCAACTAGACCACCTGGCCAGCCACACCCCCAAAGGCGCCTCGGCCCCCAGCCCCCGC
ACGCCTGTCCTCCTCCTCCCCCTCGACGTCATGTCCTCGGCCGGCGTCAAGGAAGAAGACGTGTTCCGCAGCGGA
CCCCGCGCGCCAGGCCTCCAAGACGCCGTCTTCAAAGTCGCAACCCGCGCGCACGACCACCTCCTCACGGCGAGG
GAGATGCTGGCCCGCCTGACGCGCGGAGAGGACGCTGGCCACGAGTGCGAGCACGGCGTGGTGGAGGATGATGAC
GTCTACGGCGGGGGCGACGACGATGTGCGGGAGGGGTTGAGGCGGTGCTTTGGCGTCTTTTTGGAGGCCATTCCC
GCGGGAGTCTATCTCGATGCTCTTGAAAAGGTCAACTTTGATCCGTGGGCGGTGGGGAGTTCTGGCTGGAGGCTT
CCGTGGAGGATATGGAGGGCTCTATCTAAGAGGGAGCTGTGA
Transcript >Ophcf2|01703
ATGCATCGACCCTCGCTCGTCGCCAATGGTCTCGCAAGGCTCATACGCGGTATTCGAAGCTACGCGACAGACGCC
GACATCGCCTCCGCTCGAAGCTACTGTCTAACCCAACTCCAGAAAAGCCATCATGAAGCACACCTCATCCACCGC
TTCGTCCCCCCCCCCATTCAAGACGCCTACGCCGCCCTCCGCGCCTTGAACATGGAACTCGTCCGCCTTCCGGAG
CTAGTCTCCAAGCCCATCATGGGCGAAATGCGCATCAAGTTCTGGCAAGACTCTCTCGACCGCACCTTTTCCGAC
GATCCGCCCCGCGAACCCATCTGCGTCCTCCTCGGCCAAGCGCTACGCCAACTCGAGAACAGAGCCGGAGGCGAC
GCCTCTAGACAGTCCATCAAGTTCTGGATCTCGCGTCTCGTCAGGACGAGGCAGAGATACATGGACAACCGGCCG
TTTCCGAACCTGGCCGCGTTGGAGGACTACGCGGAAAACACGTACTCGACTCTCATCTACGCCACGCTCGCCTTC
ATCCCCCTCCGGTCTACGCAACTAGACCACCTGGCCAGCCACACCCCCAAAGGCGCCTCGGCCCCCAGCCCCCGC
ACGCCTGTCCTCCTCCTCCCCCTCGACGTCATGTCCTCGGCCGGCGTCAAGGAAGAAGACGTGTTCCGCAGCGGA
CCCCGCGCGCCAGGCCTCCAAGACGCCGTCTTCAAAGTCGCAACCCGCGCGCACGACCACCTCCTCACGGCGAGG
GAGATGCTGGCCCGCCTGACGCGCGGAGAGGACGCTGGCCACGAGTGCGAGCACGGCGTGGTGGAGGATGATGAC
GTCTACGGCGGGGGCGACGACGATGTGCGGGAGGGGTTGAGGCGGTGCTTTGGCGTCTTTTTGGAGGCCATTCCC
GCGGGAGTCTATCTCGATGCTCTTGAAAAGGTCAACTTTGATCCGTGGGCGGTGGGGAGTTCTGGCTGGAGGCTT
CCGTGGAGGATATGGAGGGCTCTATCTAAGAGGGAGCTGTGA
Gene >Ophcf2|01703
ATGCATCGACCCTCGCTCGTCGCCAATGGTCTCGCAAGGCTCATACGCGGTATTCGAAGCTACGCGACAGACGCC
GACATCGCCTCCGCTCGAAGCTACTGTCTAACCCAACTCCAGTACAAATTCCCCCCATCCCATCATCCAACACCC
AAACTCACACATGGTCAGGAAAAGCCATCATGAAGCACACCTCATCCACCGCTTCGTCCCCCCCCCCATTCAAGA
CGCCTACGCCGCCCTCCGCGCCTTGAACATGGAACTCGTCCGCCTTCCGGAGCTAGTCTCCAAGCCCATCATGGG
CGAAATGCGCATCAAGTTCTGGCAAGACTCTCTCGACCGCACCTTTTCCGACGATCCGCCCCGCGAACCCATCTG
CGTCCTCCTCGGCCAAGCGCTACGCCAACTCGAGAACAGAGCCGGAGGCGACGCCTCTAGACAGTCCATCAAGTT
CTGGATCTCGCGTCTCGTCAGGACGAGGCAGAGATACATGGACAACCGGCCGTTTCCGAACCTGGCCGCGTTGGA
GGACTACGCGGAAAACACGTACTCGACTCTCATCTACGCCACGCTCGCCTTCATCCCCCTCCGGTCTACGCAACT
AGACCACCTGGCCAGCCACGTGGGCAAAGCAAACGGCATCGTCGCCACCCTCCGCGGAATCCCCACCTCTCCTCC
CCCCCCAACCAATCCAGACCCCCAAAGGCGCCTCGGCCCCCAGCCCCCGCACGCCTGTCCTCCTCCTCCCCCTCG
ACGTCATGTCCTCGGCCGGCGTCAAGGAAGAAGACGTGTTCCGCAGCGGACCCCGCGCGCCAGGCCTCCAAGACG
CCGTCTTCAAAGTCGCAACCCGCGCGCACGACCACCTCCTCACGGCGAGGGAGATGCTGGCCCGCCTGACGCGCG
GAGAGGACGCTGGCCACGAGTGCGAGCACGGCGTGGTGGAGGATGATGACGTCTACGGCGGGGGCGACGACGATG
TGCGGGAGGGGTTGAGGCGGTGCTTTGGCGTCTTTTTGGAGGCCATTCCCGCGGGAGTCTATCTCGATGCTCTTG
AAAAGGTCAACTTTGATCCGTGGGCGGTGGGGAGTTCTGGCTGGAGGCTTCCGTGGAGGATATGGAGGGCTCTAT
CTAAGAGGGAGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail