Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01692
Gene name
Locationscaffold_02:162039..165652
Strand+
Gene length (bp)3613
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01793 Glyco_transf_15 Glycolipid 2-alpha-mannosyltransferase 1.2E-96 109 422
PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A 7.8E-32 533 655

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0000030 mannosyltransferase activity Yes
GO:0006486 protein glycosylation Yes
GO:0019538 protein metabolic process No
GO:0110165 cellular anatomical entity No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0016758 hexosyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043413 macromolecule glycosylation No
GO:0043412 macromolecule modification No
GO:0070085 glycosylation No
GO:0008150 biological_process No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 53 75 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 92.85 50.52 135.17
Alive In ants, during behavior modification 120.14 62.55 177.73
Dead In ants, recently dead 132.91 68.31 197.52

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.218773 no
Alive Dead 0.618993 no
Dead Fungus 0.073457 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01692
MDLFRRASRMVPSPRPLQLPEHDEKRAPSRRKGFASRLAFFRRPLRLRGNSSVSVPLGVVIIFPLLVVVLILVLF
VRHPSSPSRIMMPAGAPPSIRKISEKHDKVFVTGCLEPDTSKPRANAAFVVLARNKELDGVIQSIKSVERHFNRW
YHYPYVFLNDGEFDDTFKDTVRNYTSANVEFGRVGPDMWGYPDWIDPKVAKEGIAKQGDAAVMYGGLESYHAMCR
FYSGFFYKHELLLKYDWYWRVEPEITYFCDITYDPFLKMMEHNKTYGFTIAVKELRETVPNIFRYASAYKRVNNI
TSQGLWEMFVEPQDPADEKRKDPNLPEEVLQTDPSKLAPAEIDPEAMEGEKYNMCHFWSNFEIARLDWFRSKEYN
DFFDMMDRSGGFWMERWGDAPIHSLAAGALLSPGDIHYFRDFGYRHTTIQHCPANAPARQLPRQPYLETTTLDEK
KRIEEDQYWANWDEVKENGVGCRCRCDTDIVDVEGKEGSCLADCLAGIALQQPRHASILASLANNKGAVKERRRV
GRGPSSGRGKTSGRGHKGQGQHGKVKPWFQGGQTPLIVRHGRMGFENKRALKMSEVNLDRLQDWIDNGRIDASKP
ITPKEMILSKLSGSIKDGIKILSRGVTKLRQPIKITASRASAGAIAAIEAAGGSIITRYYTKTALRRLVRGESVH
SDEPLPRGEEFVEGMVARAREAGFPYRLPDATSRRDIEYYRDAAHRGYLSGMLKKGESPSLYWKVPEEGREKKRK
RKKGVVKVQEKKVAVTTMW*
Coding >Ophcf2|01692
ATGGATCTCTTCAGGCGGGCTTCGAGGATGGTCCCCTCGCCCAGACCGCTGCAGTTACCCGAGCACGACGAGAAG
CGGGCGCCCTCGAGACGCAAAGGCTTCGCTTCCCGTTTGGCTTTCTTTCGCAGGCCTCTGAGGTTACGCGGCAAC
TCGTCCGTCTCCGTCCCGCTCGGCGTCGTCATCATCTTTCCCCTCCTCGTCGTCGTCCTCATCCTCGTCCTCTTC
GTCAGGCATCCCAGCTCTCCCAGCCGCATCATGATGCCCGCTGGCGCTCCGCCCTCTATCCGCAAGATAAGCGAA
AAGCATGACAAGGTCTTCGTCACTGGTTGCCTCGAGCCCGACACTAGCAAGCCCCGAGCCAATGCCGCCTTTGTC
GTCCTCGCCCGCAACAAGGAGCTCGACGGCGTCATCCAGTCCATCAAGTCGGTCGAGCGCCACTTCAATCGCTGG
TATCACTATCCCTACGTCTTCCTCAACGACGGCGAGTTCGACGACACCTTCAAGGACACCGTCCGCAACTACACG
TCGGCAAATGTCGAGTTTGGCAGGGTCGGGCCCGACATGTGGGGTTATCCTGACTGGATCGATCCCAAGGTTGCC
AAGGAGGGCATTGCCAAACAGGGAGACGCTGCCGTCATGTACGGCGGCTTGGAGAGCTATCATGCCATGTGTCGC
TTCTACTCTGGTTTTTTTTACAAGCACGAACTCTTGCTCAAGTACGATTGGTACTGGCGCGTCGAGCCCGAAATC
ACCTACTTTTGCGACATCACCTACGACCCCTTTCTCAAGATGATGGAGCACAACAAGACGTACGGCTTCACCATT
GCCGTCAAGGAGCTCCGCGAGACGGTGCCCAACATCTTTCGCTACGCCTCGGCATACAAGCGCGTCAACAACATT
ACCTCGCAGGGCCTCTGGGAGATGTTTGTCGAGCCCCAGGACCCCGCCGACGAGAAGCGCAAGGACCCCAACCTT
CCCGAAGAAGTCCTCCAGACCGATCCCAGCAAGCTCGCGCCGGCCGAGATCGATCCCGAGGCTATGGAGGGCGAA
AAGTACAACATGTGTCATTTTTGGTCCAACTTCGAGATTGCCCGCCTCGACTGGTTCCGCAGCAAAGAGTACAAC
GACTTTTTCGACATGATGGATCGCAGTGGTGGCTTCTGGATGGAACGGTGGGGTGACGCGCCCATTCACTCGTTG
GCCGCAGGAGCCCTGCTGTCTCCTGGCGATATCCATTACTTTCGCGACTTTGGCTACCGGCACACGACGATACAG
CACTGTCCCGCCAACGCGCCGGCCCGGCAGCTACCACGCCAGCCTTACCTCGAGACGACGACGTTGGACGAGAAG
AAGCGGATCGAGGAGGACCAATACTGGGCCAACTGGGACGAGGTCAAGGAGAACGGCGTCGGTTGCCGCTGTCGA
TGCGACACGGACATCGTCGACGTCGAGGGCAAGGAGGGATCTTGCCTGGCCGACTGCCTGGCGGGCATCGCGCTC
CAGCAGCCACGGCATGCTTCGATCCTCGCCAGCCTGGCCAACAACAAGGGGGCTGTCAAAGAACGGAGGAGGGTC
GGGCGAGGGCCGTCGTCTGGTCGTGGCAAGACTTCGGGGAGAGGTCACAAGGGTCAGGGTCAGCATGGGAAGGTG
AAGCCTTGGTTTCAAGGTGGACAGACGCCGTTGATTGTGAGGCATGGACGAATGGGATTTGAGAATAAACGAGCG
CTCAAGATGTCGGAGGTCAACCTCGATAGGCTGCAGGACTGGATCGACAATGGACGGATAGACGCGAGCAAGCCC
ATTACGCCCAAGGAGATGATCCTCAGCAAGCTTTCGGGCAGCATCAAGGACGGCATCAAGATTCTCTCCCGCGGC
GTAACCAAACTCCGGCAACCCATCAAGATAACGGCATCGCGAGCCTCGGCGGGCGCCATCGCAGCCATCGAGGCA
GCGGGCGGGAGCATCATCACGCGCTACTACACCAAGACGGCGCTACGGCGTCTTGTGCGAGGCGAGTCGGTGCAC
AGCGACGAGCCGCTTCCTCGGGGAGAGGAGTTCGTCGAGGGGATGGTGGCCCGGGCGCGCGAGGCGGGGTTCCCG
TACCGGTTGCCGGACGCGACGAGCAGGAGGGATATCGAGTATTATCGCGATGCGGCGCATAGGGGGTATCTGAGT
GGGATGCTGAAGAAGGGGGAGTCGCCGAGTCTGTATTGGAAGGTTCCCGAGGAGGGGAGGGAGAAGAAGAGGAAG
AGGAAGAAGGGGGTTGTGAAGGTTCAGGAGAAGAAGGTGGCTGTTACTACGATGTGGTGA
Transcript >Ophcf2|01692
ATGGATCTCTTCAGGCGGGCTTCGAGGATGGTCCCCTCGCCCAGACCGCTGCAGTTACCCGAGCACGACGAGAAG
CGGGCGCCCTCGAGACGCAAAGGCTTCGCTTCCCGTTTGGCTTTCTTTCGCAGGCCTCTGAGGTTACGCGGCAAC
TCGTCCGTCTCCGTCCCGCTCGGCGTCGTCATCATCTTTCCCCTCCTCGTCGTCGTCCTCATCCTCGTCCTCTTC
GTCAGGCATCCCAGCTCTCCCAGCCGCATCATGATGCCCGCTGGCGCTCCGCCCTCTATCCGCAAGATAAGCGAA
AAGCATGACAAGGTCTTCGTCACTGGTTGCCTCGAGCCCGACACTAGCAAGCCCCGAGCCAATGCCGCCTTTGTC
GTCCTCGCCCGCAACAAGGAGCTCGACGGCGTCATCCAGTCCATCAAGTCGGTCGAGCGCCACTTCAATCGCTGG
TATCACTATCCCTACGTCTTCCTCAACGACGGCGAGTTCGACGACACCTTCAAGGACACCGTCCGCAACTACACG
TCGGCAAATGTCGAGTTTGGCAGGGTCGGGCCCGACATGTGGGGTTATCCTGACTGGATCGATCCCAAGGTTGCC
AAGGAGGGCATTGCCAAACAGGGAGACGCTGCCGTCATGTACGGCGGCTTGGAGAGCTATCATGCCATGTGTCGC
TTCTACTCTGGTTTTTTTTACAAGCACGAACTCTTGCTCAAGTACGATTGGTACTGGCGCGTCGAGCCCGAAATC
ACCTACTTTTGCGACATCACCTACGACCCCTTTCTCAAGATGATGGAGCACAACAAGACGTACGGCTTCACCATT
GCCGTCAAGGAGCTCCGCGAGACGGTGCCCAACATCTTTCGCTACGCCTCGGCATACAAGCGCGTCAACAACATT
ACCTCGCAGGGCCTCTGGGAGATGTTTGTCGAGCCCCAGGACCCCGCCGACGAGAAGCGCAAGGACCCCAACCTT
CCCGAAGAAGTCCTCCAGACCGATCCCAGCAAGCTCGCGCCGGCCGAGATCGATCCCGAGGCTATGGAGGGCGAA
AAGTACAACATGTGTCATTTTTGGTCCAACTTCGAGATTGCCCGCCTCGACTGGTTCCGCAGCAAAGAGTACAAC
GACTTTTTCGACATGATGGATCGCAGTGGTGGCTTCTGGATGGAACGGTGGGGTGACGCGCCCATTCACTCGTTG
GCCGCAGGAGCCCTGCTGTCTCCTGGCGATATCCATTACTTTCGCGACTTTGGCTACCGGCACACGACGATACAG
CACTGTCCCGCCAACGCGCCGGCCCGGCAGCTACCACGCCAGCCTTACCTCGAGACGACGACGTTGGACGAGAAG
AAGCGGATCGAGGAGGACCAATACTGGGCCAACTGGGACGAGGTCAAGGAGAACGGCGTCGGTTGCCGCTGTCGA
TGCGACACGGACATCGTCGACGTCGAGGGCAAGGAGGGATCTTGCCTGGCCGACTGCCTGGCGGGCATCGCGCTC
CAGCAGCCACGGCATGCTTCGATCCTCGCCAGCCTGGCCAACAACAAGGGGGCTGTCAAAGAACGGAGGAGGGTC
GGGCGAGGGCCGTCGTCTGGTCGTGGCAAGACTTCGGGGAGAGGTCACAAGGGTCAGGGTCAGCATGGGAAGGTG
AAGCCTTGGTTTCAAGGTGGACAGACGCCGTTGATTGTGAGGCATGGACGAATGGGATTTGAGAATAAACGAGCG
CTCAAGATGTCGGAGGTCAACCTCGATAGGCTGCAGGACTGGATCGACAATGGACGGATAGACGCGAGCAAGCCC
ATTACGCCCAAGGAGATGATCCTCAGCAAGCTTTCGGGCAGCATCAAGGACGGCATCAAGATTCTCTCCCGCGGC
GTAACCAAACTCCGGCAACCCATCAAGATAACGGCATCGCGAGCCTCGGCGGGCGCCATCGCAGCCATCGAGGCA
GCGGGCGGGAGCATCATCACGCGCTACTACACCAAGACGGCGCTACGGCGTCTTGTGCGAGGCGAGTCGGTGCAC
AGCGACGAGCCGCTTCCTCGGGGAGAGGAGTTCGTCGAGGGGATGGTGGCCCGGGCGCGCGAGGCGGGGTTCCCG
TACCGGTTGCCGGACGCGACGAGCAGGAGGGATATCGAGTATTATCGCGATGCGGCGCATAGGGGGTATCTGAGT
GGGATGCTGAAGAAGGGGGAGTCGCCGAGTCTGTATTGGAAGGTTCCCGAGGAGGGGAGGGAGAAGAAGAGGAAG
AGGAAGAAGGGGGTTGTGAAGGTTCAGGAGAAGAAGGTGGCTGTTACTACGATGTGGTGA
Gene >Ophcf2|01692
ATGGATCTCTTCAGGCGGGCTTCGAGGATGGTCCCCTCGCCCAGACCGCTGCAGTTACCCGAGCACGACGAGAAG
CGGGCGCCCTCGAGACGCAAAGGCTTCGCTTCCCGTTTGGCTTTCTTTCGCAGGCCTCTGAGGTTACGCGGCAAC
TCGTCCGTCTCCGTCCCGCTCGGCGTCGTCATCATCTTTCCCCTCCTCGTCGTCGTCCTCATCCTCGTCCTCTTC
GTCAGGCATCCCAGCTCTCCCAGCCGCATCATGATGCCCGCTGGCGCTCCGCCCTCTATCCGGTTAGCTCCATGA
CCCGCGCTTGGCCCGCTCTTTGCTGACCCGAGTCGCGTCTGCAGCAAGATAAGCGAAAAGCATGACAAGGTCTTC
GTCACTGGTTGCCTCGAGCCCGACACTAGCAAGCCCCGAGCCAATGCCGCCTTTGTCGTCCTCGCCCGCAACAAG
GAGCTCGACGGCGTCATCCAGTCCATCAAGTCGGTCGAGCGCCACTTCAATCGCTGGTATCACTATCCCTACGTC
TTCCTCAACGACGGCGAGTTCGACGACACCTTCAAGGACACCGTCCGCAACTACACGTCGGCAAATGTCGAGTTT
GGCAGGGTCGGGCCCGACATGTGGGGTTATCCTGACTGGATCGATCCCAAGGTTGCCAAGGAGGGCATTGCCAAA
CAGGGAGACGCTGCCGTCATGTACGGCGGCTTGGAGAGCTATCATGCCATGTGTCGCTTCTACTCTGGGTAAGCC
GCCGCCGCCCATCTTTACTAGTCCGCTTCGGTGCCGTTGCTAAAGATGACGTCGACGCACAGTTTTTTTTACAAG
CACGAACTCTTGCTCAAGTACGATTGGTACTGGCGCGTCGAGCCCGAAATCACCTACTTTTGCGACATCACCTAG
TAAGCGCACCTCGCACGGCCCCCGTCGGCCCCCGTCGCCCACTGACTCTGCTGCCCGTCCCTCCAGCGACCCCTT
TCTCAAGATGATGGAGCACAACAAGACGTACGGCTTCACCATTGCCGTCAAGGAGCTCCGCGAGACGGTGCCCAA
CATCTTTCGCTACGCCTCGGCATACAAGCGCGTCAACAACATTACCTCGCAGGGCCTCTGGGAGATGTTTGTCGA
GCCCCAGGACCCCGCCGACGAGAAGCGCAAGGACCCCAACCTTCCCGAAGAAGTCCTCCAGACCGATCCCAGCAA
GCTCGCGCCGGCCGAGATCGATCCCGAGGCTATGGAGGGCGAAAAGTACAACATGTGTCATTTTTGGTCCAACTT
CGAGATTGCCCGCCTCGACTGGTTCCGCAGCAAAGAGTACAACGACTTTTTCGACATGATGGATCGCAGTGGTGG
CTTCTGGATGGAACGGGTTCGTTTCCTCCCCTTTCAGATCCGCAAGTCTCGCCTGTTGTCTGACCGTCGATAGTG
GGGTGACGCGCCCATTCACTCGTTGGCCGCAGGAGCCCTGCTGTCTCCTGGCGATATCCATTACTTTCGCGACTT
TGGCTACCGGCACACGACGATACAGCACTGTCCCGCCAACGCGCCGGCCCGGCAGCTACCACGCCAGCCTTACCT
CGAGACGACGACGTTGGACGAGAAGAAGCGGATCGAGGAGGACCAATACTGGGCCAACTGGGACGAGGTCAAGGA
GAACGGCGTCGGTTGCCGCTGTCGATGCGACACGGACATCGTCGACGTCGAGGGCAAGGAGGGATCTTGCCTGGC
CGAGTGGGTCGACGTGGCGGGCGGCTGGGCGAGCCCTTGAGAAGCTTGACGAGGTCGGCTTGGTCTCGACGACAG
AGGAGGGAGGAAGAACGGCGCCGGGCCGCATCCTTGAGTCCCGCGAGTGGCGCGTCTGAAGGATAGGCCGGCCGC
CCAAGCGCCCATGTCCTCCTCCGAGGAACAGCGCAGCCTCCGGGGCTGGCTCAGAGGCACGTCGAGGAAAGGGCG
GCGAGGAGACGATGCCGGAAGAGCACAGCCGTTTGACACGCAGCCATGTTGGCAAGACGAGAAGAACGGCATCAC
GACTTTTTTAATCTCAGCGAAACAGAATTTGGGGGCGTCGATATGCGAGGGAGCGCACCACATGTGGGATAAGGC
ATCATCATGTCGGCGACAGCCGGCTTGTACACACATCGGGGTTTTTTTCCAAGGCTTCAGAGTCGGGCAGGCGGA
CGGGCCGCTCGGTGGCACAAATGTGGGAACAGCATTTTGTTTTGGCGGCAGCGAGTCTTGTTTGATGCTCTTTGA
ATCAAGACTAATTCTTTACCATTTACGTGTTTACTTTTGGACTCGGCCGTTGATGACGATGCTGAAGACTCGATA
CAAGGAGAACTACGCCGAGGTTGAGGGCCGACCGTGTCTACATACATAAGCAGTCTCGCAGTATAAGCGGCTCAT
CGTCCTTGTCCTGCCCTCGGAGGTTGAAGATGTTGAAGCGTGGAGCCTGGAGGAAGAGATGGTGGTGTAGGGTAG
GGTAGGGTAGGGTAGGGTAGGGACTAGGGTAGATGCTCTGCTCGCAAACTTGATCACGTGACTGAACTATGACAA
GCTGCAAAGCTCGAGATGGGTTCCAAGAACCATCAACCTCGGAAGCCTCTTGGGCACGATGCCTCCCCGGCCCCT
GCCCATAACGGCGCTTGCATTGCGGGTCGCATCGAACAGAGCTTGCGCGACGTCTACGATAAGCTGCCTGGCGGG
CATCGCGCTCCAGCAGCCACGGCATGCTTCGATCCTCGCCAGCCTGGCCAACAACAAGGGGGCTGTCAAAGAACG
GAGGAGGGTCGGGCGAGGGCCGTCGTCTGGTCGTGGCAAGACTTCGGGGAGAGGTCACAAGGGTCAGGGTCAGCA
TGGGAAGGTGAAGCCTTGGTTTCAAGGTGGACAGACGCCGTTGATTGTGAGGCATGGACGAATGGGATTTGAGAA
TAAGTGAGGACCAGGACTGCCCCCCCCCTTTTTTTTATTTTTTGGAAACATTATATATATGTTATCCTCTTTGGA
CAACTGACGGACGTGATGCAGACGAGCGCTCAAGATGTCGGAGGTCAACCTCGATAGGCTGCAGGACTGGATCGA
CAATGGACGGATAGACGCGAGCAAGCCCATTACGCCCAAGGAGATGATCCTCAGCAAGCTTTCGGGCAGCATCAA
GGACGGCATCAAGATTCTCTCCCGCGGCGTAACCAAACTCCGGCAACCCATCAAGATAACGGCATCGCGAGCCTC
GGCGGGCGCCATCGCAGCCATCGAGGCAGCGGGCGGGAGCATCATCACGCGCTACTACACCAAGACGGCGCTACG
GCGTCTTGTGCGAGGCGAGTCGGTGCACAGCGACGAGCCGCTTCCTCGGGGAGAGGAGTTCGTCGAGGGGATGGT
GGCCCGGGCGCGCGAGGCGGGGTTCCCGTACCGGTTGCCGGACGCGACGAGCAGGAGGGATATCGAGTATTATCG
CGATGCGGCGCATAGGGGGTATCTGAGTGGGATGCTGAAGAAGGGGGAGTCGCCGAGTCTGTATTGGAAGGTTCC
CGAGGAGGGGAGGGAGAAGAAGAGGAAGAGGAAGAAGGGGGTTGTGAAGGTTCAGGAGAAGAAGGTGGCTGTTAC
TACGATGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail