Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01685
Gene name
Locationscaffold_02:148135..148462
Strand+
Gene length (bp)327
Transcript length (bp)267
Coding sequence length (bp)267
Protein length (aa) 89

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 49 71 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 185.38 77.32 293.44
Alive In ants, during behavior modification 132.00 46.96 217.04
Dead In ants, recently dead 153.84 59.51 248.18

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.210123 no
Alive Dead 0.561170 no
Dead Fungus 0.522819 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01685
MAVLDAFSSFFASLSDALSSLVQAIYGLISGLFQSVAGVIGSGLRMLGGAGQFVLANSLALVIGAAVTLAFIKYT
TQGRRLASGVKRN*
Coding >Ophcf2|01685
ATGGCCGTCCTCGACGCATTCTCCAGCTTCTTCGCCTCCCTCTCCGATGCCTTGTCCTCCTTGGTTCAAGCCATC
TACGGCCTCATCTCGGGACTCTTCCAGTCGGTAGCCGGCGTCATTGGTTCAGGGTTGAGGATGCTGGGAGGTGCC
GGCCAGTTTGTACTCGCAAACTCCCTTGCCCTCGTCATCGGTGCTGCCGTCACACTGGCTTTCATCAAGTACACG
ACTCAAGGTCGACGACTGGCTTCGGGCGTCAAGAGGAATTAG
Transcript >Ophcf2|01685
ATGGCCGTCCTCGACGCATTCTCCAGCTTCTTCGCCTCCCTCTCCGATGCCTTGTCCTCCTTGGTTCAAGCCATC
TACGGCCTCATCTCGGGACTCTTCCAGTCGGTAGCCGGCGTCATTGGTTCAGGGTTGAGGATGCTGGGAGGTGCC
GGCCAGTTTGTACTCGCAAACTCCCTTGCCCTCGTCATCGGTGCTGCCGTCACACTGGCTTTCATCAAGTACACG
ACTCAAGGTCGACGACTGGCTTCGGGCGTCAAGAGGAATTAG
Gene >Ophcf2|01685
ATGGCCGTCCTCGACGCATTCTCCAGCTTCTTCGCCTCCCTCTCCGATGCCTTGTCCTCCTTGGTTCAAGCCATC
TACGGCCTCATCTCGGGACTCTTCCAGTCGGTAGCCGGCGTCATTGGTTCAGGGTTGAGGATGCTGGGAGGTGCC
GGCCAGTTTGTACTCGGTAAGCTTCAAACGTTACTCCGTGCGACGGACTTTATGCTGATGGTTGTTGTTTCTCAA
GCAAACTCCCTTGCCCTCGTCATCGGTGCTGCCGTCACACTGGCTTTCATCAAGTACACGACTCAAGGTCGACGA
CTGGCTTCGGGCGTCAAGAGGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail