Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01675
Gene name
Locationscaffold_02:127116..127594
Strand+
Gene length (bp)478
Transcript length (bp)378
Coding sequence length (bp)378
Protein length (aa) 126

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 1.0E-16 17 111

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7299 0.4514 0.025 0.1106 0.3122 0.0237 0.3145 0.282 0.2203 0.0113

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup279
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4592
Ophiocordyceps australis map64 (Brazil) OphauB2|8117
Ophiocordyceps camponoti-floridani Ophcf2|01675 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05204
Ophiocordyceps camponoti-rufipedis Ophun1|5093
Ophiocordyceps camponoti-rufipedis Ophun1|5409
Ophiocordyceps kimflemingae Ophio5|4500
Ophiocordyceps kimflemingae Ophio5|4716
Ophiocordyceps subramaniannii Hirsu2|4530
Ophiocordyceps subramaniannii Hirsu2|5995
Ophiocordyceps subramaniannii Hirsu2|6830

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01675
MPQDTFTSDKVPEISSKNQLDDLLRANHFLVLQAHASWCAPCKAISPFFRQQAEDVARPDVLAFARFDSGRAEDL
VRELGIQALPTFVFFEGGQRVQSLTGANRLALQKAVEDIKLKSDAAFPVS*
Coding >Ophcf2|01675
ATGCCCCAAGACACCTTCACCAGCGACAAAGTCCCCGAAATCTCCTCCAAGAACCAACTAGACGACCTCCTCCGC
GCCAACCACTTCCTCGTCCTCCAGGCCCACGCTTCCTGGTGTGCCCCTTGCAAGGCCATCTCCCCCTTCTTCCGT
CAGCAGGCCGAAGACGTCGCCCGCCCGGACGTCCTGGCTTTTGCCCGCTTCGACTCCGGTCGCGCCGAGGACCTG
GTGCGCGAGCTCGGCATACAGGCCCTTCCTACCTTTGTCTTCTTCGAGGGTGGGCAGAGGGTTCAGTCGTTGACG
GGGGCGAATCGACTGGCCTTGCAGAAGGCTGTTGAGGATATCAAGCTCAAGTCTGACGCTGCTTTCCCCGTCTCC
TAG
Transcript >Ophcf2|01675
ATGCCCCAAGACACCTTCACCAGCGACAAAGTCCCCGAAATCTCCTCCAAGAACCAACTAGACGACCTCCTCCGC
GCCAACCACTTCCTCGTCCTCCAGGCCCACGCTTCCTGGTGTGCCCCTTGCAAGGCCATCTCCCCCTTCTTCCGT
CAGCAGGCCGAAGACGTCGCCCGCCCGGACGTCCTGGCTTTTGCCCGCTTCGACTCCGGTCGCGCCGAGGACCTG
GTGCGCGAGCTCGGCATACAGGCCCTTCCTACCTTTGTCTTCTTCGAGGGTGGGCAGAGGGTTCAGTCGTTGACG
GGGGCGAATCGACTGGCCTTGCAGAAGGCTGTTGAGGATATCAAGCTCAAGTCTGACGCTGCTTTCCCCGTCTCC
TAG
Gene >Ophcf2|01675
ATGCCCCAAGACACCTTCACCAGCGACAAAGTCCCCGAAATCTCCTCCAAGAACCAACTAGACGACCTCCTCCGC
GCCAACCACTTCCTCGTCCTCCAGGCCCACGCTTCCTGGTGTGCCCCTTGCAAGGCCATCTCCCCCTTCTTCCGT
CAGCAGGCCGAAGACGTCGCCCGCCCGGACGTCCTGGCTTTTGCCCGCTTCGACTCCGGTCGCGCCGAGGACCTG
GTGCGCGAGCTCGGCATACAGGCCCTTCCTACCTTTGTCTTCTTCGAGGGTGGGCAGAGGGTTCAGTCGTTGACG
GGGGCGAATCGACTGGCCTTGCAGAAGGCTGTTGAGGATATCAAGCTCAAGTCTGACGCTGCTGTGAGTACTGTC
TTGGGCGTGAATCTGTTTCTCCTCTCGTCTCTCTTGAATATAGTACTGTCTTGGGTTTTTTTTTTGGTGTCTGAC
TCTAGCCATCTAGTTCCCCGTCTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail