Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01671
Gene name
Locationscaffold_02:116714..118106
Strand+
Gene length (bp)1392
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03595 SLAC1 Voltage-dependent anion channel 2.1E-82 106 441

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 107 129 22
2 141 163 22
3 178 200 22
4 207 229 22
5 244 266 22
6 278 300 22
7 360 382 22
8 389 411 22
9 421 443 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01671
MSTQVVTGQAISAPDLGPWSNSNSSTRRNSVDIYTSGSGGRSVTEKRRLNNSNNNSQLEPGFYYYPGEKAGRSDN
NAGGNVEAQAAVVDPNDPNRPRLPLRQRLHHFTWAWYTLSMSTGGLAVLIFAQPHQFKGLRTIGLVVYVINLLIF
TVITVLLLTRFFLHPGDLTRSLMHQREGFFFPTFFLAIATIITGTDRYLIPKNDVALVWAISGAFWAYLAFTLIL
AVGQYSYVFASHSFGLQTMMPTWILPIFPIMLSGTIASVIAETQPEIAATPIIVAGLTCQGLGLSVAFMMYAHMI
GRLMQSGLPNREHRPGLFMCVGPPSFTALALIGMANGLPVRSSATAEGTFLDVGVIKTVALLCAIFLWALSLWWF
SIAAVAVIQSPPKYFHLGCWAMVFPNSGFTLATIAIGRALGSEPVLWVGTAMSIVIVMAYLIVLFFNVRAVVVQD
IMYPNRDEDVEDH*
Coding >Ophcf2|01671
ATGAGCACCCAAGTGGTAACAGGCCAGGCCATCTCGGCGCCCGACCTCGGCCCCTGGTCCAACTCCAACTCTTCC
ACCCGACGCAACTCGGTGGACATTTACACGTCCGGAAGCGGCGGCCGGTCCGTGACGGAGAAGAGACGGCTCAAC
AACAGCAACAACAACTCGCAGCTCGAGCCGGGCTTCTACTACTACCCCGGAGAGAAGGCCGGCAGGTCCGACAAC
AACGCGGGCGGAAACGTCGAAGCCCAAGCGGCAGTCGTGGACCCCAATGATCCGAACCGGCCCCGGCTTCCGCTC
CGGCAGCGTCTCCATCACTTTACCTGGGCATGGTATACCCTCTCCATGAGCACGGGCGGTCTCGCCGTCCTCATC
TTCGCGCAACCCCATCAATTCAAGGGTCTGCGAACAATCGGACTGGTAGTCTACGTCATCAACCTCCTCATCTTC
ACCGTCATCACCGTCCTGCTCCTCACCCGCTTCTTCCTACACCCCGGAGACCTGACGCGATCGCTGATGCATCAG
AGAGAGGGCTTCTTCTTCCCAACCTTCTTCCTAGCCATCGCCACCATCATCACGGGCACGGACCGCTATCTGATC
CCCAAGAACGACGTGGCTCTCGTATGGGCCATCTCGGGCGCCTTCTGGGCTTACCTGGCCTTCACCCTGATCCTC
GCCGTCGGCCAGTACAGCTACGTCTTCGCCTCGCACAGCTTCGGCCTACAGACCATGATGCCGACCTGGATCCTT
CCCATCTTCCCCATCATGCTTTCGGGGACCATCGCCTCCGTCATAGCCGAGACGCAGCCCGAAATCGCAGCCACG
CCCATCATCGTCGCCGGCCTCACCTGTCAGGGCTTGGGCCTATCCGTCGCCTTTATGATGTACGCCCACATGATC
GGCCGTCTGATGCAATCCGGCCTCCCCAACCGAGAACACCGTCCGGGCCTCTTCATGTGCGTCGGACCACCATCC
TTCACCGCCCTGGCCCTCATCGGCATGGCCAACGGTCTCCCCGTGAGGTCGAGCGCCACCGCCGAGGGAACCTTT
CTCGACGTGGGCGTCATCAAGACAGTGGCACTGTTGTGCGCCATCTTCCTCTGGGCCCTGAGTCTGTGGTGGTTC
AGCATCGCCGCCGTGGCCGTCATCCAGTCGCCGCCCAAGTATTTCCACCTGGGCTGTTGGGCCATGGTGTTTCCC
AACAGCGGATTCACCTTGGCGACCATTGCCATCGGAAGAGCGCTGGGGAGCGAGCCCGTGTTGTGGGTTGGCACG
GCCATGTCCATCGTCATCGTCATGGCCTATCTGATTGTCCTCTTCTTTAATGTCCGGGCCGTGGTTGTACAGGAC
ATAATGTATCCGAACCGGGACGAGGACGTGGAAGACCATTGA
Transcript >Ophcf2|01671
ATGAGCACCCAAGTGGTAACAGGCCAGGCCATCTCGGCGCCCGACCTCGGCCCCTGGTCCAACTCCAACTCTTCC
ACCCGACGCAACTCGGTGGACATTTACACGTCCGGAAGCGGCGGCCGGTCCGTGACGGAGAAGAGACGGCTCAAC
AACAGCAACAACAACTCGCAGCTCGAGCCGGGCTTCTACTACTACCCCGGAGAGAAGGCCGGCAGGTCCGACAAC
AACGCGGGCGGAAACGTCGAAGCCCAAGCGGCAGTCGTGGACCCCAATGATCCGAACCGGCCCCGGCTTCCGCTC
CGGCAGCGTCTCCATCACTTTACCTGGGCATGGTATACCCTCTCCATGAGCACGGGCGGTCTCGCCGTCCTCATC
TTCGCGCAACCCCATCAATTCAAGGGTCTGCGAACAATCGGACTGGTAGTCTACGTCATCAACCTCCTCATCTTC
ACCGTCATCACCGTCCTGCTCCTCACCCGCTTCTTCCTACACCCCGGAGACCTGACGCGATCGCTGATGCATCAG
AGAGAGGGCTTCTTCTTCCCAACCTTCTTCCTAGCCATCGCCACCATCATCACGGGCACGGACCGCTATCTGATC
CCCAAGAACGACGTGGCTCTCGTATGGGCCATCTCGGGCGCCTTCTGGGCTTACCTGGCCTTCACCCTGATCCTC
GCCGTCGGCCAGTACAGCTACGTCTTCGCCTCGCACAGCTTCGGCCTACAGACCATGATGCCGACCTGGATCCTT
CCCATCTTCCCCATCATGCTTTCGGGGACCATCGCCTCCGTCATAGCCGAGACGCAGCCCGAAATCGCAGCCACG
CCCATCATCGTCGCCGGCCTCACCTGTCAGGGCTTGGGCCTATCCGTCGCCTTTATGATGTACGCCCACATGATC
GGCCGTCTGATGCAATCCGGCCTCCCCAACCGAGAACACCGTCCGGGCCTCTTCATGTGCGTCGGACCACCATCC
TTCACCGCCCTGGCCCTCATCGGCATGGCCAACGGTCTCCCCGTGAGGTCGAGCGCCACCGCCGAGGGAACCTTT
CTCGACGTGGGCGTCATCAAGACAGTGGCACTGTTGTGCGCCATCTTCCTCTGGGCCCTGAGTCTGTGGTGGTTC
AGCATCGCCGCCGTGGCCGTCATCCAGTCGCCGCCCAAGTATTTCCACCTGGGCTGTTGGGCCATGGTGTTTCCC
AACAGCGGATTCACCTTGGCGACCATTGCCATCGGAAGAGCGCTGGGGAGCGAGCCCGTGTTGTGGGTTGGCACG
GCCATGTCCATCGTCATCGTCATGGCCTATCTGATTGTCCTCTTCTTTAATGTCCGGGCCGTGGTTGTACAGGAC
ATAATGTATCCGAACCGGGACGAGGACGTGGAAGACCATTGA
Gene >Ophcf2|01671
ATGAGCACCCAAGTGGTAACAGGCCAGGCCATCTCGGCGCCCGACCTCGGCCCCTGGTCCAACTCCAACTCTTCC
ACCCGACGCAACTCGGTGGACATTTACACGTCCGGAAGCGGCGGCCGGTCCGTGACGGAGAAGAGACGGCTCAAC
AACAGCAACAACAACTCGCAGCTCGAGCCGGGCTTCTACTACTACCCCGGAGAGAAGGCCGGCAGGTCCGACAAC
AACGCGGGCGGAAACGTCGAAGCCCAAGCGGCAGTCGTGGACCCCAATGATCCGAACCGGCCCCGGCTTCCGCTC
CGGCAGCGTCTCCATCACTTTACCTGGGCATGGTATACCCTCTCCATGAGCACGGGCGGTCTCGCCGTCCTCATC
TTCGCGCAACCCCATCAATTCAAGGGTCTGCGAACAATCGGACTGGTAGTCTACGTCATCAACCTCCTCATCTTC
ACCGTCATCACCGTCCTGCTCCTCACCCGCTTCTTCCTACACCCCGGAGACCTGACGCGATCGCTGATGCATCAG
AGAGAGGGCTTCTTCTTCCCAACCTTCTTCCTAGCCATCGCCACCATCATCACGGGCACGGACCGCTATCTGATC
CCCAAGAACGACGTGGCTCTCGTATGGGCCATCTCGGGCGCCTTCTGGGCTTACCTGGCCTTCACCCTGATCCTC
GCCGTCGGCCAGTACAGCTACGTCTTCGCCTCGCACAGCTTCGGCCTACAGACCATGATGCCGACCTGGATCCTT
CCCATCTTCCCCATCATGCTTTCGGGGACCATCGCCTCCGTCATAGCCGAGACGCAGCCCGAAATCGCAGCCACG
CCCATCATCGTCGCCGGCCTCACCTGTCAGGGCTTGGGCCTATCCGTCGCCTTTATGATGTACGCCCACATGATC
GGCCGTCTGATGCAATCCGGCCTCCCCAACCGAGAACACCGTCCGGGCCTCTTCATGTGCGTCGGACCACCATCC
TTCACCGCCCTGGCCCTCATCGGCATGGCCAACGGTCTCCCCGTGAGGTCGAGCGCCACCGCCGAGGGAACCTTT
CTCGACGTGGGCGTCATCAAGACAGTGGCACTGTTGTGCGCCATCTTCCTCTGGGCCCTGAGTCTGTGGTGGTTC
AGCATCGCCGCCGTGGCCGTCATCCAGTCGCCGCCCAAGTATTTCCACCTGGGCTGTTGGGCCATGGTGTTTCCC
AACAGCGGATTCACCTTGGCGACCATTGCCATCGGAAGAGCGCTGGGGAGCGAGCCCGTGTTGTGGGTTGGCACG
GCCATGTCCATCGTCATCGTCATGGCCTATCTGATTGTCCTCTTCTTTAATGTCCGGGCCGTGGTTGTACAGGAC
ATAATGTATCCGAACCGGGACGAGGACGTGGAAGACCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail