Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01670
Gene name
Locationscaffold_02:111108..113744
Strand-
Gene length (bp)2636
Transcript length (bp)2133
Coding sequence length (bp)2133
Protein length (aa) 711

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00795 CN_hydrolase Carbon-nitrogen hydrolase 2.8E-29 5 282
PF02540 NAD_synthase NAD synthase 1.6E-25 342 605

GO

GO Term Description Terminal node
GO:0006807 nitrogen compound metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7958 0.5244 0.0082 0.0692 0.0245 0.0059 0.176 0.0671 0.0407 0.0034

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup778
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2054
Ophiocordyceps australis map64 (Brazil) OphauB2|3180
Ophiocordyceps camponoti-floridani Ophcf2|01670 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5539
Ophiocordyceps kimflemingae Ophio5|753
Ophiocordyceps subramaniannii Hirsu2|290
Ophiocordyceps subramaniannii Hirsu2|8606

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01670
MFLVTVAAATLPSVPLDFLGNRHRILESIRIAKEKGAVLRTGPELEIPGYACLDHHLEGDTFLHSWEVLADIISD
EVCKGMLIDLGLGVRHRNVRYNARVLCTYRNIFCIRPKMALANDGLYREARHFTAWSKPREVETYYLESVVRRVT
GQETVPIGDMILSTPDTAVTCESCEEMFVPLNPSIFTGLNGAEIILNSSASHAELRKLRARLELIANSTRKLGGI
YVYANATGTDGEARMMHDGSSMIIQNGEVLAQGSQFSLAPVEVTVATVDIEKVRSYRSSISRNVQAARQPDFPRV
HCHLVLSRPVEDIWLSNQPEISRPVELNVMDPMEEIHMATAVYLWQYLTRTNSAGFFLALSGGLDSSTVALFVYG
MARLVLASIKAGEETTLQHLRRVTGEKNLVPATPRDIVGRLLHTCYMGTVNSSRETEDRARRLAEMIGAHHSSIT
IDETVAAHEAMVSKALGMKPKYEVEGGSRSENLAKQNIQARSRMVVAYSLAQLSTTARELPRAGCALLVLGSGNV
DEILRGYFTKYDASSADIAPLGSISKNDAKDFQRWARQKWNLPILTEFLEATPTAELLPLSAGVQSDEDENEMGL
TYEELSVFGVLRKVDKLGPWSAYLRLLSDWRDRPGYGPREIAEKVFRFFRYYAMNRHKSTICTPSIHLCPYDPDD
NRHDLRPFLYVVDWPWQFRKIREHVERLEAQLKAD*
Coding >Ophcf2|01670
ATGTTCTTGGTGACCGTCGCCGCGGCCACTCTTCCCAGCGTGCCGCTCGACTTTCTCGGAAATCGTCATCGCATT
CTCGAGTCGATTCGAATAGCAAAGGAAAAGGGCGCCGTGCTGAGAACCGGCCCTGAGCTGGAAATCCCGGGCTAT
GCCTGTCTCGATCATCACCTCGAGGGCGACACCTTCTTGCACTCGTGGGAAGTTCTCGCCGACATCATCTCGGAT
GAGGTCTGCAAGGGCATGCTCATCGACCTCGGCCTCGGCGTACGACATCGCAATGTCCGATATAATGCGCGCGTT
CTCTGCACGTACCGCAACATCTTCTGCATCCGACCCAAGATGGCGCTGGCCAACGACGGCCTCTACCGTGAGGCC
AGACACTTTACCGCCTGGAGCAAGCCGCGCGAGGTTGAGACGTACTATCTCGAGAGCGTTGTACGGCGCGTCACG
GGCCAGGAGACGGTTCCTATTGGTGACATGATTCTCTCGACGCCGGATACGGCCGTGACGTGCGAGTCTTGCGAG
GAAATGTTTGTTCCGCTGAATCCCTCCATCTTTACTGGTCTCAACGGTGCCGAAATAATACTCAACTCGAGCGCC
TCTCACGCTGAACTTCGAAAACTTCGCGCCCGGCTGGAGCTCATTGCCAACTCCACCAGGAAGCTCGGGGGCATC
TACGTCTATGCCAACGCGACGGGCACCGATGGCGAGGCTCGCATGATGCACGACGGCAGCAGCATGATTATACAG
AATGGCGAGGTATTGGCTCAAGGAAGTCAGTTTTCCCTCGCGCCCGTTGAGGTTACCGTCGCCACCGTCGACATC
GAAAAGGTCCGGAGCTACCGCAGCAGCATCAGCCGCAACGTCCAGGCCGCCAGGCAGCCCGACTTTCCGCGCGTC
CACTGCCATCTGGTCTTGTCCCGGCCAGTCGAGGATATTTGGCTGTCCAACCAGCCCGAGATCTCTCGGCCGGTC
GAGCTCAACGTCATGGATCCCATGGAGGAGATACACATGGCCACTGCCGTCTACCTGTGGCAGTACTTGACGCGG
ACCAACTCTGCCGGCTTCTTCCTGGCCCTGTCTGGCGGTCTCGACAGTTCGACCGTAGCGCTCTTCGTCTACGGC
ATGGCCCGGCTTGTACTGGCCTCCATCAAGGCCGGAGAGGAGACGACGCTGCAGCATCTGCGGCGTGTGACGGGC
GAAAAGAACCTGGTCCCTGCCACGCCTCGAGACATCGTAGGCCGTCTGCTCCACACGTGCTACATGGGAACCGTC
AACTCGTCGCGCGAGACCGAGGACAGGGCCAGGAGGCTGGCCGAGATGATTGGCGCGCACCACTCCAGCATTACC
ATCGACGAAACCGTCGCCGCGCACGAGGCCATGGTCAGCAAGGCGCTTGGCATGAAGCCCAAATACGAGGTCGAG
GGCGGCTCTCGATCCGAGAATCTCGCCAAGCAAAACATCCAGGCGCGCAGCCGGATGGTCGTTGCCTACTCGCTT
GCCCAGTTGTCGACGACGGCCCGGGAGCTCCCTAGAGCAGGATGCGCCTTGCTGGTGCTGGGATCGGGCAACGTC
GACGAGATTCTCCGCGGTTACTTTACCAAATACGACGCCAGCTCGGCTGATATCGCGCCGCTCGGAAGCATCTCC
AAGAACGATGCCAAGGACTTTCAGCGATGGGCCCGGCAGAAGTGGAACCTCCCCATCTTGACTGAGTTTCTCGAG
GCGACACCGACGGCTGAGCTGCTTCCGCTCTCGGCTGGCGTGCAGAGCGACGAGGACGAGAATGAGATGGGCCTG
ACGTACGAGGAGTTGTCCGTGTTCGGGGTTTTGAGAAAGGTGGACAAGCTCGGCCCCTGGTCTGCTTACCTCCGC
CTCCTGAGCGACTGGAGGGACCGGCCAGGCTACGGCCCGCGCGAGATTGCGGAAAAGGTCTTTCGCTTCTTCCGC
TACTACGCCATGAACAGGCACAAGTCCACCATCTGCACGCCCAGCATACACCTCTGCCCGTACGACCCGGACGAC
AACAGGCACGACTTGCGGCCGTTTCTTTACGTCGTCGACTGGCCATGGCAGTTTCGCAAGATTCGAGAGCATGTC
GAGAGGTTGGAGGCGCAGCTCAAGGCGGATTGA
Transcript >Ophcf2|01670
ATGTTCTTGGTGACCGTCGCCGCGGCCACTCTTCCCAGCGTGCCGCTCGACTTTCTCGGAAATCGTCATCGCATT
CTCGAGTCGATTCGAATAGCAAAGGAAAAGGGCGCCGTGCTGAGAACCGGCCCTGAGCTGGAAATCCCGGGCTAT
GCCTGTCTCGATCATCACCTCGAGGGCGACACCTTCTTGCACTCGTGGGAAGTTCTCGCCGACATCATCTCGGAT
GAGGTCTGCAAGGGCATGCTCATCGACCTCGGCCTCGGCGTACGACATCGCAATGTCCGATATAATGCGCGCGTT
CTCTGCACGTACCGCAACATCTTCTGCATCCGACCCAAGATGGCGCTGGCCAACGACGGCCTCTACCGTGAGGCC
AGACACTTTACCGCCTGGAGCAAGCCGCGCGAGGTTGAGACGTACTATCTCGAGAGCGTTGTACGGCGCGTCACG
GGCCAGGAGACGGTTCCTATTGGTGACATGATTCTCTCGACGCCGGATACGGCCGTGACGTGCGAGTCTTGCGAG
GAAATGTTTGTTCCGCTGAATCCCTCCATCTTTACTGGTCTCAACGGTGCCGAAATAATACTCAACTCGAGCGCC
TCTCACGCTGAACTTCGAAAACTTCGCGCCCGGCTGGAGCTCATTGCCAACTCCACCAGGAAGCTCGGGGGCATC
TACGTCTATGCCAACGCGACGGGCACCGATGGCGAGGCTCGCATGATGCACGACGGCAGCAGCATGATTATACAG
AATGGCGAGGTATTGGCTCAAGGAAGTCAGTTTTCCCTCGCGCCCGTTGAGGTTACCGTCGCCACCGTCGACATC
GAAAAGGTCCGGAGCTACCGCAGCAGCATCAGCCGCAACGTCCAGGCCGCCAGGCAGCCCGACTTTCCGCGCGTC
CACTGCCATCTGGTCTTGTCCCGGCCAGTCGAGGATATTTGGCTGTCCAACCAGCCCGAGATCTCTCGGCCGGTC
GAGCTCAACGTCATGGATCCCATGGAGGAGATACACATGGCCACTGCCGTCTACCTGTGGCAGTACTTGACGCGG
ACCAACTCTGCCGGCTTCTTCCTGGCCCTGTCTGGCGGTCTCGACAGTTCGACCGTAGCGCTCTTCGTCTACGGC
ATGGCCCGGCTTGTACTGGCCTCCATCAAGGCCGGAGAGGAGACGACGCTGCAGCATCTGCGGCGTGTGACGGGC
GAAAAGAACCTGGTCCCTGCCACGCCTCGAGACATCGTAGGCCGTCTGCTCCACACGTGCTACATGGGAACCGTC
AACTCGTCGCGCGAGACCGAGGACAGGGCCAGGAGGCTGGCCGAGATGATTGGCGCGCACCACTCCAGCATTACC
ATCGACGAAACCGTCGCCGCGCACGAGGCCATGGTCAGCAAGGCGCTTGGCATGAAGCCCAAATACGAGGTCGAG
GGCGGCTCTCGATCCGAGAATCTCGCCAAGCAAAACATCCAGGCGCGCAGCCGGATGGTCGTTGCCTACTCGCTT
GCCCAGTTGTCGACGACGGCCCGGGAGCTCCCTAGAGCAGGATGCGCCTTGCTGGTGCTGGGATCGGGCAACGTC
GACGAGATTCTCCGCGGTTACTTTACCAAATACGACGCCAGCTCGGCTGATATCGCGCCGCTCGGAAGCATCTCC
AAGAACGATGCCAAGGACTTTCAGCGATGGGCCCGGCAGAAGTGGAACCTCCCCATCTTGACTGAGTTTCTCGAG
GCGACACCGACGGCTGAGCTGCTTCCGCTCTCGGCTGGCGTGCAGAGCGACGAGGACGAGAATGAGATGGGCCTG
ACGTACGAGGAGTTGTCCGTGTTCGGGGTTTTGAGAAAGGTGGACAAGCTCGGCCCCTGGTCTGCTTACCTCCGC
CTCCTGAGCGACTGGAGGGACCGGCCAGGCTACGGCCCGCGCGAGATTGCGGAAAAGGTCTTTCGCTTCTTCCGC
TACTACGCCATGAACAGGCACAAGTCCACCATCTGCACGCCCAGCATACACCTCTGCCCGTACGACCCGGACGAC
AACAGGCACGACTTGCGGCCGTTTCTTTACGTCGTCGACTGGCCATGGCAGTTTCGCAAGATTCGAGAGCATGTC
GAGAGGTTGGAGGCGCAGCTCAAGGCGGATTGA
Gene >Ophcf2|01670
ATGTTCTTGGTGACCGTCGCCGCGGCCACTCTTCCCAGCGTGCCGCTCGACTTTCTCGGAAATCGTCATCGCATT
CTCGAGTCGATTCGAATAGCAAAGGAAAAGGGCGCCGTGCTGAGAACCGGCCCTGAGCTGGAAATCCCGGGCTAT
GCCTGTCTCGATCATCACCTCGAGGGTCGGATGAGTTGCCGTCTGCGTGGCTGGCTTTTTCACTGACGTTCGACA
GGCGACACCTTCTTGCACTCGTGGGAAGTTCTCGCCGACATCATCTCGGATGAGGTCTGCAAGGGCATGCTCATC
GACCTCGGCGTCAGTCGCGGTCACGGCCCATCTTCTCCTCGGTGAAGAGATTGGTTGACGAGATGACAGCTCGGC
GTACGACATCGCAATGTCCGATATAATGCGCGCGTTCTCTGCACGTACCGCAACATCTTCTGCATCCGACCCAAG
ATGGCGCTGGCCAACGACGGCCTCTACCGTGAGGCCAGACACTTTACCGCCTGGAGCAAGCCGCGCGAGGTTGAG
ACGTACTATCTCGAGAGCGTTGTACGGCGCGTCACGGGCCAGGAGACGGTTCCTATTGGTGACATGATTCTCTCG
ACGCCGGATACGGCCGTGACGTGCGAGTCTTGCGAGGAAATGTTTGTTCCGCTGAATCCCTCCATCTTTACTGGT
CTCAACGGTGTAAGTCGGCTTCAATAACGATGCATCTTTGCTTCTCACTATACTGACTGTCAACAGGCCGAAATA
ATACTCAACTCGAGCGCCTCTCACGGTATGCTTCACCCAGTGTCATGACGCCCCCCCCCCCCCCCCATTCGTTAA
CCCGCGTAGCTGAACTTCGAAAACTTCGCGCCCGGCTGGAGCTCATTGCCAACTCCACCAGGAAGCTCGGGGGCA
TCTACGTCTATGCCAACGCGACGGGTGTGTGCGTCCTCTACTAGCCTCAAGCAATGGCTCTCGCTCTGACGTCGA
CGCAGGCACCGATGGCGAGGCTCGCATGATGCACGACGGCAGCAGCATGATTATACAGAATGGCGAGGTATTGGC
TCAAGGAAGTCAGTTTTCCCTCGCGCCCGTTGAGGTTACCGTCGCCACCGTCGACATCGAAAAGGTCCGGAGCTA
CCGCAGCAGCATCAGCCGCAACGTCCAGGCCGCCAGGCAGCCCGACTTTCCGCGCGTCCACTGCCATCTGGTCTT
GTCCCGGCCAGTCGAGGATATTTGGCTGTCCAACCAGCCCGAGATCTCTCGGCCGGTCGAGCTCAACGTCATGGA
TCCCATGGAGGAGATACACATGGCCACTGCCGTCTACCTGTGGCAGTACTTGACGCGGACCAACTCTGCCGGCTT
CTTCCTGGCCCTGTCTGGCGGTCTCGACAGTTCGACCGTAGCGCTCTTCGTCTACGGCATGGCCCGGCTTGTACT
GGCCTCCATCAAGGCCGGAGAGGAGACGACGCTGCAGCATCTGCGGCGTGTGACGGGCGAAAAGAACCTGGTCCC
TGCCACGCCTCGAGACATCGTAGGCCGTCTGCTCCACACGTGCTACATGGGAACCGTCAACTCGTCGCGCGAGAC
CGAGGACAGGGCCAGGAGGCTGGCCGAGATGATTGGCGCGCACCACTCCAGCATTACCATCGACGAAACCGTCGC
CGCGCACGAGGCCATGGTCAGCAAGGCGCTTGGCATGAAGCCCAAATACGAGGTCGAGGGCGGCTCTCGATCCGA
GAATCTCGCCAAGCAAAACATCCAGGCGCGCAGCCGGATGGTCGTTGCCTACTCGCTTGCCCAGTTGTCGACGAC
GGCCCGGGAGCTCCCTAGAGCAGGATGCGCCTTGCTGGTGCTGGGATCGGGCAACGTCGACGAGGTAGACAGCTG
AAGACTGAAGACTGAAAATACTATGCATCTCTCATTGCTGACTTGTCGACAGATTCTCCGCGGTTACTTTACCAA
ATACGTACGTCTGCTCTTCTAGGCTCGGAGCAAACAAGCTGACTGGCGTGGCGGTTCCTGCGTAGGACGCCAGCT
CGGCTGATATCGCGCCGCTCGGAAGCATCTCCAAGAACGATGCCAAGGACTTTCAGCGATGGGCCCGGCAGAAGT
GGAACCTCCCCATCTTGACTGAGTTTCTCGAGGCGACACCGACGGCTGAGCTGCTTCCGCTCTCGGCTGGCGTGC
AGAGCGACGAGGACGAGAATGAGATGGGCCTGACGTACGAGGAGTTGTCCGTGTTCGGGGTTAGTCAAGGCTACC
ACGTCCCTTGATCATCAACAGACACAGACAGCTACTGCATACACTCTTGTACCCGGTTTCGCTGATGGGAAGAGA
CGCAGGTTTTGAGAAAGGTGGACAAGCTCGGCCCCTGGTCTGCTTACCTCCGCCTCCTGAGCGACTGGAGGGACC
GGCCAGGCTACGGCCCGCGCGAGATTGCGGAAAAGGTCTTTCGCTTCTTCCGCTACTACGCCATGAACAGGCACA
AGTCCACCATCTGCACGCCCAGCATACACCTCTGCCCGTACGACCCGGACGACAACAGGCACGACTTGCGGCCGT
TTCTTTACGTCGTCGACTGGCCATGGCAGTTTCGCAAGATTCGAGAGCATGTCGAGAGGTTGGAGGCGCAGCTCA
AGGCGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail