Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01664
Gene name
Locationscaffold_02:99645..101597
Strand+
Gene length (bp)1952
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 4.8E-80 56 501
PF07690 MFS_1 Major Facilitator Superfamily 3.1E-24 60 435
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.0E-06 82 241

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 92 111 19
3 120 139 19
4 144 166 22
5 179 201 22
6 206 228 22
7 301 323 22
8 338 360 22
9 367 389 22
10 402 424 22
11 431 453 22
12 463 485 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 4.86 1.57 8.15
Alive In ants, during behavior modification 66.65 37.64 95.65
Dead In ants, recently dead 30.68 16.45 44.90

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01664
MTPKLDLETVEVAHANHVNALISEMDRQLDAAGGPQKGFFHPRFRHPRHFTWLLVAFASMGGLLSGLDQSLISGA
NLYLPADLGLSDRENSLVNSGMPLGAVGGALLLSPANEYFGRKGAIIISIVLYTVGAALEAGSFNFAMMVAARVI
LGLGVGLEGGTVPVYVAETVERSIRGNLVSLYQFNIALGEVLGYAVAAMFLKVAGNWRFILGSSLLFSTVMFMGM
LFLPESPRYLMHKGRKLDSYKVWKRIRGTESSESRLEFFLMAATVEEDGLTGQGDEAKNRRFPWLDFFTVPRARR
ALVYANVMVLLGQLTGINAIMYYMSVLMNQIGFDPERANYMSLVGGGSLLVGTIPAIFLMERFGRRFWAVTMLPG
FLTGLVLIGVSYQIPLQTHTMAVEACYLTGLIIYMAFFGSYACLTWVIPSEVYPTYLRSYGMTTSDALLFFASFI
VTYNFTAMQKVMTRTGLTLGFYGGIALIGELYQILLMPETKNKTLEEIDAVMSRPTLEIARENWAGVRENVRKLL
ACRFGDVFLQRQGRSGPMEKE*
Coding >Ophcf2|01664
ATGACGCCCAAACTCGACCTCGAAACCGTCGAAGTCGCCCACGCCAACCATGTAAACGCCCTCATCTCCGAAATG
GACCGTCAGCTCGATGCCGCCGGCGGTCCGCAGAAAGGCTTCTTCCATCCTCGCTTCCGCCACCCTCGTCACTTC
ACCTGGCTGCTGGTGGCCTTTGCCAGCATGGGCGGTCTTCTCTCAGGGCTGGATCAGAGCCTCATCTCCGGCGCC
AACTTGTATCTCCCCGCCGACCTTGGGCTTTCGGATCGGGAGAATAGCCTCGTCAACTCGGGGATGCCGTTGGGG
GCGGTGGGGGGCGCGCTCCTGCTCTCGCCGGCGAATGAGTACTTTGGACGCAAGGGGGCCATCATCATCTCCATC
GTGCTGTATACCGTCGGGGCAGCTCTTGAGGCGGGCTCCTTTAATTTCGCCATGATGGTGGCCGCCCGCGTCATC
CTCGGTCTGGGCGTCGGTCTAGAAGGCGGGACGGTGCCCGTCTATGTAGCCGAGACGGTCGAGCGCAGCATCCGA
GGCAACCTGGTGTCCCTCTACCAGTTCAACATTGCCCTGGGCGAGGTTCTCGGATACGCCGTGGCGGCCATGTTC
CTCAAGGTGGCTGGCAACTGGCGGTTCATCCTAGGCTCGTCTCTGTTGTTTTCGACGGTCATGTTTATGGGAATG
CTTTTCCTTCCCGAGAGCCCGAGATATCTCATGCACAAGGGCAGGAAACTCGACTCTTACAAGGTCTGGAAGCGG
ATCCGCGGCACCGAGTCGAGCGAGTCGCGTCTCGAGTTCTTCCTCATGGCTGCTACCGTTGAGGAAGACGGCTTG
ACGGGTCAGGGTGATGAGGCCAAGAACCGACGCTTCCCATGGCTCGACTTCTTCACCGTCCCTCGAGCTCGCAGA
GCGCTCGTCTACGCCAACGTCATGGTCCTCCTCGGCCAGCTTACCGGCATCAACGCCATCATGTACTACATGTCC
GTCCTCATGAACCAGATCGGCTTCGACCCCGAGCGGGCAAACTACATGTCCCTCGTCGGCGGAGGCTCACTCCTC
GTCGGCACCATACCGGCCATCTTCTTGATGGAGCGATTCGGACGCCGCTTCTGGGCCGTGACGATGCTTCCCGGA
TTCCTGACTGGTCTTGTTCTCATCGGCGTCTCGTATCAGATTCCGCTGCAGACGCATACCATGGCTGTCGAGGCC
TGCTATCTCACGGGGCTCATCATCTACATGGCCTTTTTCGGCTCGTACGCCTGTCTGACTTGGGTGATTCCGTCC
GAGGTGTATCCAACTTACCTACGCAGCTACGGCATGACCACATCAGACGCCCTCCTCTTCTTCGCCTCCTTCATC
GTGACCTACAACTTCACCGCCATGCAAAAAGTCATGACGCGAACAGGCCTCACACTGGGTTTCTACGGCGGCATC
GCCCTCATCGGAGAGCTGTACCAGATCCTCCTCATGCCCGAGACGAAGAACAAGACGCTCGAGGAGATTGACGCC
GTCATGTCGAGGCCCACGCTCGAAATCGCCCGCGAGAACTGGGCGGGTGTGAGGGAGAATGTGAGGAAACTACTT
GCTTGTCGGTTTGGAGACGTCTTTCTACAGCGGCAAGGGAGGTCTGGTCCGATGGAGAAGGAGTAG
Transcript >Ophcf2|01664
ATGACGCCCAAACTCGACCTCGAAACCGTCGAAGTCGCCCACGCCAACCATGTAAACGCCCTCATCTCCGAAATG
GACCGTCAGCTCGATGCCGCCGGCGGTCCGCAGAAAGGCTTCTTCCATCCTCGCTTCCGCCACCCTCGTCACTTC
ACCTGGCTGCTGGTGGCCTTTGCCAGCATGGGCGGTCTTCTCTCAGGGCTGGATCAGAGCCTCATCTCCGGCGCC
AACTTGTATCTCCCCGCCGACCTTGGGCTTTCGGATCGGGAGAATAGCCTCGTCAACTCGGGGATGCCGTTGGGG
GCGGTGGGGGGCGCGCTCCTGCTCTCGCCGGCGAATGAGTACTTTGGACGCAAGGGGGCCATCATCATCTCCATC
GTGCTGTATACCGTCGGGGCAGCTCTTGAGGCGGGCTCCTTTAATTTCGCCATGATGGTGGCCGCCCGCGTCATC
CTCGGTCTGGGCGTCGGTCTAGAAGGCGGGACGGTGCCCGTCTATGTAGCCGAGACGGTCGAGCGCAGCATCCGA
GGCAACCTGGTGTCCCTCTACCAGTTCAACATTGCCCTGGGCGAGGTTCTCGGATACGCCGTGGCGGCCATGTTC
CTCAAGGTGGCTGGCAACTGGCGGTTCATCCTAGGCTCGTCTCTGTTGTTTTCGACGGTCATGTTTATGGGAATG
CTTTTCCTTCCCGAGAGCCCGAGATATCTCATGCACAAGGGCAGGAAACTCGACTCTTACAAGGTCTGGAAGCGG
ATCCGCGGCACCGAGTCGAGCGAGTCGCGTCTCGAGTTCTTCCTCATGGCTGCTACCGTTGAGGAAGACGGCTTG
ACGGGTCAGGGTGATGAGGCCAAGAACCGACGCTTCCCATGGCTCGACTTCTTCACCGTCCCTCGAGCTCGCAGA
GCGCTCGTCTACGCCAACGTCATGGTCCTCCTCGGCCAGCTTACCGGCATCAACGCCATCATGTACTACATGTCC
GTCCTCATGAACCAGATCGGCTTCGACCCCGAGCGGGCAAACTACATGTCCCTCGTCGGCGGAGGCTCACTCCTC
GTCGGCACCATACCGGCCATCTTCTTGATGGAGCGATTCGGACGCCGCTTCTGGGCCGTGACGATGCTTCCCGGA
TTCCTGACTGGTCTTGTTCTCATCGGCGTCTCGTATCAGATTCCGCTGCAGACGCATACCATGGCTGTCGAGGCC
TGCTATCTCACGGGGCTCATCATCTACATGGCCTTTTTCGGCTCGTACGCCTGTCTGACTTGGGTGATTCCGTCC
GAGGTGTATCCAACTTACCTACGCAGCTACGGCATGACCACATCAGACGCCCTCCTCTTCTTCGCCTCCTTCATC
GTGACCTACAACTTCACCGCCATGCAAAAAGTCATGACGCGAACAGGCCTCACACTGGGTTTCTACGGCGGCATC
GCCCTCATCGGAGAGCTGTACCAGATCCTCCTCATGCCCGAGACGAAGAACAAGACGCTCGAGGAGATTGACGCC
GTCATGTCGAGGCCCACGCTCGAAATCGCCCGCGAGAACTGGGCGGGTGTGAGGGAGAATGTGAGGAAACTACTT
GCTTGTCGGTTTGGAGACGTCTTTCTACAGCGGCAAGGGAGGTCTGGTCCGATGGAGAAGGAGTAG
Gene >Ophcf2|01664
ATGACGCCCAAACTCGACCTCGAAACCGTCGAAGTCGCCCACGCCAACCATGTAAACGCCCTCATCTCCGAAATG
GACCGTCAGCTCGATGCCGCCGGCGGTCCGCAGAAAGGCTTCTTCCATCCTCGCTTCCGCCACCCTCGTCACTTC
ACCTGGCTGCTGGTGGCCTTTGCCAGCATGGGCGGTCTTCTCTCAGGGCTGGATCAGAGCCTCATCTCCGGCGCC
AACTTGTATCTCCCCGCCGACCTTGGGCTTTCGGATCGGGAGAATAGCCTCGTCAACTCGGGGATGCCGTTGGGG
GCGGTGGGGGGCGCGCTCCTGCTCTCGCCGGCGAATGAGTACTTTGGACGCAAGGGGGCCATCATCATCTCCATC
GTGCTGTATACCGTCGGGGCAGCTCTTGAGGCGGGCTCCTTTAATTTCGGCGAGTTGTTTCCCCCCTATTTATAT
ATATAGTTGACTGTCTGACCGCTTGTGGATAAAAAAAAGCCATGATGGTGGCCGCCCGCGTCATCCTCGGTCTGG
GCGTCGGTCTAGAAGGCGGGACGGTGCCCGTCTATGTAGCCGAGACGGTCGAGCGCAGCATCCGAGGCAACCTGG
TGTCCCTCTACCAGTTCAACATTGCCCTGGGCGAGGTTCTCGGATACGCCGTGGCGGCCATGTTCCTCAAGGTGG
CTGGCAACTGGCGGTTCATCCTAGGCTCGTCTCTGTTGTTTTCGACGGTCATGTTTATGGGGTAAGATGCATCAT
GTTCGCTCGGCTTTTTGAGTTGACCTCGTTTAGAATGCTTTTCCTTCCCGAGAGCCCGAGATATCTCATGCACAA
GGGCAGGAAACTCGACTCTTACAAGGTCTGGAAGCGGATCCGCGGCACCGAGTCGAGCGAGTCGCGTCTCGAGTT
CTTCCTCATGGCTGCTACCGTTGAGGAAGACGGCTTGACGGGTCAGGGTGATGAGGCCAAGAACCGACGCTTCCC
ATGGCTCGACTTCTTCACGTACGTTGCATCTTGACTTTCCATTCAATATGACACCAATGACTTACTTAGATTCCT
TTTCTTCGTACCGTACATACGTGTAGCGTCCCTCGAGCTCGCAGAGCGCTCGTCTACGCCAACGTCATGGTCCTC
CTCGGCCAGCTTACCGGCATCAACGCCATCATGTACTACATGTCCGTCCTCATGAACCAGATCGGCTTCGACCCC
GAGCGGGCAAACTACATGTCCCTCGTCGGCGGAGGCTCACTCCTCGTCGGCACCATACCGGCCATCTTCTTGATG
GAGCGATTCGGACGCCGCTTCTGGGCCGTGACGATGCTTCCCGGATTCCTGACTGGTCTTGTTCTCATCGGCGTC
TCGTATCAGATTCCGCTGCAGACGCATACCATGGCTGTCGAGGCCTGCTATCTCACGGGGCTCATCATCTACATG
GCCTTTTTCGGCTCGTACGCCTGTCTGACTTGGGGTGAGCTCTTGAACTCCCGAGCTTCTTGAACTGCCGAGCTC
TTGAACTTCTGAGCTCTTGAACTCCTGACCGCTCGAAGGGGTGGTGTGTCATCGGAATCGAGCTGATTCTCGCAG
TGATTCCGTCCGAGGTGTATCCAACTTACCTACGCAGCTACGGCATGACCACATCAGACGCCCTCCTCTTCTTCG
CCTCCTTCATCGTGACCTACAACTTCACCGCCATGCAAAAAGTCATGACGCGAACAGGCCTCACACTGGGTTTCT
ACGGCGGCATCGCCCTCATCGGAGAGCTGTACCAGATCCTCCTCATGCCCGAGACGAAGAACAAGACGCTCGAGG
AGATTGACGCCGTCATGTCGAGGCCCACGCTCGAAATCGCCCGCGAGAACTGGGCGGGTGTGAGGGAGAATGTGA
GGAAACTACTTGCTTGTCGGTTTGGAGACGTCTTTCTACAGCGGCAAGGGAGGTCTGGTCCGATGGAGAAGGAGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail