Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01660
Gene name
Locationscaffold_02:84578..86749
Strand-
Gene length (bp)2171
Transcript length (bp)2049
Coding sequence length (bp)2049
Protein length (aa) 683

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03828 PAP_assoc Cid1 family poly A polymerase 1.6E-12 547 604
PF01909 NTP_transf_2 Nucleotidyltransferase domain 1.3E-06 374 473

GO

GO Term Description Terminal node
GO:0016779 nucleotidyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3778 0.9109 0.0795 0.012 0.1219 0.0156 0.0363 0.0087 0.0029 0.0094

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3504
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1281
Ophiocordyceps australis map64 (Brazil) OphauB2|4572
Ophiocordyceps camponoti-floridani Ophcf2|01660 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|201
Ophiocordyceps kimflemingae Ophio5|3694
Ophiocordyceps subramaniannii Hirsu2|6706

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01660
MSRNEPRPRRDHRDEDHRRHHRRRSSPPPLPPPSYNSWRPGAQRHDAPYRGPDSYRPRPPQGSFDFRVEKPPGIG
SLPPPGLDRRSDPPSRRRPQRNSGRSRWQPPHPSERALVSGAAFSAPAVSVREAGAANKFRNLEDLSDDDEVDME
MSSQSSSGGAKDHKPSAKRARTAAKPDADAAPKWSNPDPYTALPCPDETSTRPKRDVVKLIRKARLEEPKPSTDA
PAAAEDFIPFDMSSDEDSKPEPKMSRAPLSFRLPAKPPAPSRSRALDLDDGSGDLGSRKRTADDRIKPPDYGQSR
KAEFRPSKGLLLPEWQPVSGEDRCPWAAVGLPDGEDMSVRDSLHKEVMEFYEFARPREFEHVVRARLVEKLAAAL
RRDPMFRDGRVKPFGSFVSGLYLPTADMDLVVCSQTYLDGGPALYLSKKRWLYSFRQFLQASGIAQSGSVTVIAH
ARVPLVKFVDKVTGLKVDVSFENLGGVQAVDTFLAWKREYPEMPILVTVIKHFLLMRGLNEPVSGGIGGFSVICL
VVSMLQMMPPTQSKSQQGIYHLGDLLLYFLELYGRRFEYRNLAISLTRPVGYIKKSEVKRLTYKNPNRLSIIDPN
NPSNDISGGSSNTTAILARFNDASVELRERMTEVSQQADKGSILGVILEGNYSSFKTQRQYLKQVHEEKLGPCYN
QEKKHMM*
Coding >Ophcf2|01660
ATGTCGCGCAACGAGCCGCGCCCTCGACGCGATCATCGCGACGAAGATCACCGTCGTCACCATCGCCGTCGTTCG
TCGCCGCCGCCTCTGCCGCCTCCCTCGTACAACAGCTGGCGCCCCGGAGCCCAGCGCCACGACGCGCCTTACCGC
GGTCCCGACTCGTACAGGCCCCGTCCGCCGCAGGGCAGCTTCGACTTTCGCGTTGAGAAGCCGCCCGGCATCGGC
TCCCTGCCGCCTCCCGGTCTTGACCGCCGCTCGGATCCACCTTCGCGTCGTCGCCCGCAGCGCAATTCCGGCCGT
TCGCGTTGGCAGCCTCCTCATCCGTCGGAGCGGGCCCTCGTCTCGGGCGCTGCCTTTAGTGCTCCTGCCGTGAGC
GTCAGAGAGGCAGGGGCCGCCAACAAGTTTCGAAACCTCGAGGACCTCTCCGACGATGACGAGGTAGACATGGAA
ATGTCGTCTCAGTCGTCGTCCGGGGGGGCCAAAGACCACAAACCCTCCGCCAAGCGCGCTCGCACTGCCGCCAAG
CCAGACGCCGACGCAGCGCCAAAATGGTCCAATCCCGACCCCTACACGGCGCTGCCCTGTCCCGACGAGACGTCG
ACGCGCCCCAAGCGTGACGTCGTCAAGCTCATCCGCAAAGCTCGCTTGGAGGAACCCAAGCCCAGCACCGACGCC
CCTGCGGCTGCCGAGGATTTCATCCCCTTCGACATGAGCAGCGACGAAGACTCCAAACCAGAGCCAAAGATGTCG
AGAGCTCCGCTCTCCTTTCGTCTCCCCGCTAAACCGCCGGCGCCTTCGCGCTCTCGGGCCCTCGATCTCGACGAC
GGCTCGGGCGACCTCGGCTCGCGCAAGCGCACCGCCGATGATCGCATCAAGCCCCCCGACTACGGCCAGTCCAGA
AAGGCCGAATTCAGGCCGTCCAAGGGGTTGCTGCTCCCCGAGTGGCAGCCCGTCAGCGGCGAGGACCGGTGCCCC
TGGGCCGCCGTCGGGCTCCCGGATGGCGAAGACATGTCCGTTCGCGATAGCTTGCACAAGGAGGTGATGGAGTTT
TACGAATTCGCCAGACCGAGAGAGTTTGAGCACGTCGTCAGGGCCAGACTCGTCGAGAAGCTGGCGGCCGCTCTG
CGACGCGACCCCATGTTCCGCGACGGACGCGTCAAGCCGTTTGGCTCCTTCGTCTCCGGGCTGTACCTGCCGACG
GCCGACATGGACCTCGTCGTCTGCTCCCAGACATATCTGGATGGGGGCCCGGCGCTGTACTTGTCCAAGAAGCGC
TGGCTCTACAGTTTCAGGCAGTTCCTTCAAGCATCCGGCATCGCCCAGTCTGGGTCGGTCACCGTCATCGCTCAC
GCTCGCGTTCCGCTGGTCAAGTTCGTGGATAAGGTCACGGGCCTCAAGGTGGACGTGTCGTTTGAGAACCTGGGA
GGCGTGCAGGCGGTCGATACGTTCTTGGCCTGGAAGCGCGAATATCCCGAGATGCCGATTCTGGTGACGGTCATC
AAGCACTTTTTGCTGATGCGTGGTCTCAACGAGCCCGTCAGCGGCGGCATCGGCGGCTTCTCCGTCATCTGCCTC
GTCGTCAGCATGTTGCAGATGATGCCGCCCACGCAGAGCAAGAGCCAGCAGGGCATCTACCACCTCGGCGATCTG
CTTCTGTATTTCTTGGAGCTCTATGGACGACGCTTCGAGTACCGGAACTTGGCCATTTCGCTGACGCGGCCCGTG
GGATACATCAAAAAGTCCGAGGTGAAGAGACTAACGTACAAGAACCCCAATCGGCTGTCCATCATCGACCCCAAC
AATCCGTCCAACGACATCTCGGGTGGATCGTCCAACACGACGGCCATCTTGGCTCGCTTCAACGACGCCTCTGTC
GAGTTGCGCGAGAGGATGACGGAGGTGTCGCAGCAGGCCGACAAGGGAAGCATCCTCGGTGTCATCCTCGAGGGT
AACTACTCGAGCTTCAAGACGCAGCGACAGTACCTCAAGCAGGTCCACGAAGAGAAGCTGGGGCCGTGCTATAAC
CAGGAGAAGAAGCACATGATGTGA
Transcript >Ophcf2|01660
ATGTCGCGCAACGAGCCGCGCCCTCGACGCGATCATCGCGACGAAGATCACCGTCGTCACCATCGCCGTCGTTCG
TCGCCGCCGCCTCTGCCGCCTCCCTCGTACAACAGCTGGCGCCCCGGAGCCCAGCGCCACGACGCGCCTTACCGC
GGTCCCGACTCGTACAGGCCCCGTCCGCCGCAGGGCAGCTTCGACTTTCGCGTTGAGAAGCCGCCCGGCATCGGC
TCCCTGCCGCCTCCCGGTCTTGACCGCCGCTCGGATCCACCTTCGCGTCGTCGCCCGCAGCGCAATTCCGGCCGT
TCGCGTTGGCAGCCTCCTCATCCGTCGGAGCGGGCCCTCGTCTCGGGCGCTGCCTTTAGTGCTCCTGCCGTGAGC
GTCAGAGAGGCAGGGGCCGCCAACAAGTTTCGAAACCTCGAGGACCTCTCCGACGATGACGAGGTAGACATGGAA
ATGTCGTCTCAGTCGTCGTCCGGGGGGGCCAAAGACCACAAACCCTCCGCCAAGCGCGCTCGCACTGCCGCCAAG
CCAGACGCCGACGCAGCGCCAAAATGGTCCAATCCCGACCCCTACACGGCGCTGCCCTGTCCCGACGAGACGTCG
ACGCGCCCCAAGCGTGACGTCGTCAAGCTCATCCGCAAAGCTCGCTTGGAGGAACCCAAGCCCAGCACCGACGCC
CCTGCGGCTGCCGAGGATTTCATCCCCTTCGACATGAGCAGCGACGAAGACTCCAAACCAGAGCCAAAGATGTCG
AGAGCTCCGCTCTCCTTTCGTCTCCCCGCTAAACCGCCGGCGCCTTCGCGCTCTCGGGCCCTCGATCTCGACGAC
GGCTCGGGCGACCTCGGCTCGCGCAAGCGCACCGCCGATGATCGCATCAAGCCCCCCGACTACGGCCAGTCCAGA
AAGGCCGAATTCAGGCCGTCCAAGGGGTTGCTGCTCCCCGAGTGGCAGCCCGTCAGCGGCGAGGACCGGTGCCCC
TGGGCCGCCGTCGGGCTCCCGGATGGCGAAGACATGTCCGTTCGCGATAGCTTGCACAAGGAGGTGATGGAGTTT
TACGAATTCGCCAGACCGAGAGAGTTTGAGCACGTCGTCAGGGCCAGACTCGTCGAGAAGCTGGCGGCCGCTCTG
CGACGCGACCCCATGTTCCGCGACGGACGCGTCAAGCCGTTTGGCTCCTTCGTCTCCGGGCTGTACCTGCCGACG
GCCGACATGGACCTCGTCGTCTGCTCCCAGACATATCTGGATGGGGGCCCGGCGCTGTACTTGTCCAAGAAGCGC
TGGCTCTACAGTTTCAGGCAGTTCCTTCAAGCATCCGGCATCGCCCAGTCTGGGTCGGTCACCGTCATCGCTCAC
GCTCGCGTTCCGCTGGTCAAGTTCGTGGATAAGGTCACGGGCCTCAAGGTGGACGTGTCGTTTGAGAACCTGGGA
GGCGTGCAGGCGGTCGATACGTTCTTGGCCTGGAAGCGCGAATATCCCGAGATGCCGATTCTGGTGACGGTCATC
AAGCACTTTTTGCTGATGCGTGGTCTCAACGAGCCCGTCAGCGGCGGCATCGGCGGCTTCTCCGTCATCTGCCTC
GTCGTCAGCATGTTGCAGATGATGCCGCCCACGCAGAGCAAGAGCCAGCAGGGCATCTACCACCTCGGCGATCTG
CTTCTGTATTTCTTGGAGCTCTATGGACGACGCTTCGAGTACCGGAACTTGGCCATTTCGCTGACGCGGCCCGTG
GGATACATCAAAAAGTCCGAGGTGAAGAGACTAACGTACAAGAACCCCAATCGGCTGTCCATCATCGACCCCAAC
AATCCGTCCAACGACATCTCGGGTGGATCGTCCAACACGACGGCCATCTTGGCTCGCTTCAACGACGCCTCTGTC
GAGTTGCGCGAGAGGATGACGGAGGTGTCGCAGCAGGCCGACAAGGGAAGCATCCTCGGTGTCATCCTCGAGGGT
AACTACTCGAGCTTCAAGACGCAGCGACAGTACCTCAAGCAGGTCCACGAAGAGAAGCTGGGGCCGTGCTATAAC
CAGGAGAAGAAGCACATGATGTGA
Gene >Ophcf2|01660
ATGTCGCGCAACGAGCCGCGCCCTCGACGCGATCATCGCGACGAAGATCACCGTCGTCACCATCGCCGTCGTTCG
TCGCCGCCGCCTCTGCCGCCTCCCTCGTACAACAGCTGGCGCCCCGGAGCCCAGCGCCACGACGCGCCTTACCGC
GGTCCCGACTCGTACAGGCCCCGTCCGCCGCAGGGCAGCTTCGACTTTCGCGTTGAGAAGCCGCCCGGCATCGGC
TCCCTGCCGCCTCCCGGTCTTGACCGCCGCTCGGATCCACCTTCGCGTCGTCGCCCGCAGCGCAATTCCGGCCGT
TCGCGTTGGCAGCCTCCTCATCCGTCGGAGCGGGCCCTCGTCTCGGGCGCTGCCTTTAGTGCTCCTGCCGTGAGC
GTCAGAGAGGCAGGGGCCGCCAACAAGTTTCGAAACCTCGAGGACCTCTCCGACGATGACGAGGTAGACATGGAA
ATGTCGTCTCAGTCGTCGTCCGGGGGGGCCAAAGACCACAAACCCTCCGCCAAGCGCGCTCGCACTGCCGCCAAG
CCAGACGCCGACGCAGCGCCAAAATGGTCCAATCCCGACCCCTACACGGCGCTGCCCTGTCCCGACGAGACGTCG
ACGCGCCCCAAGCGTGACGTCGTCAAGCTCATCCGCAAAGCTCGCTTGGAGGAACCCAAGCCCAGCACCGACGCC
CCTGCGGCTGCCGAGGATTTCATCCCCTTCGACATGAGCAGCGACGAAGACTCCAAACCAGAGCCAAAGATGTCG
AGAGCTCCGCTCTCCTTTCGTCTCCCCGCTAAACCGCCGGCGCCTTCGCGCTCTCGGGCCCTCGATCTCGACGAC
GGCTCGGGCGACCTCGGCTCGCGCAAGCGCACCGCCGATGATCGCATCAAGCCCCCCGACTACGGCCAGTCCAGA
AAGGCCGAATTCAGGCCGTCCAAGGGGTTGCTGCTCCCCGAGTGGCAGCCCGTCAGCGGCGAGGACCGGTGCCCC
TGGGCCGCCGTCGGGCTCCCGGATGGCGAAGACATGTCCGTTCGGCAAGTTAGCCCCGAGGTCGTCCTTGTTTGA
GAGCTCGCCAGCTAATTCGAGGTAGCGATAGCTTGCACAAGGAGGTGATGGAGTTTTACGAATTCGCCAGACCGA
GAGAGTTTGAGCACGTCGTCAGGGCCAGACTCGTCGAGAAGCTGGCGGCCGCTCTGCGACGCGACCCCATGTTCC
GCGACGGACGCGTCAAGCCGTTTGGCTCCTTCGTCTCCGGGCTGTACCTGCCGACGGCCGACATGGACCTCGTCG
TCTGCTCCCAGACATATCTGGATGGGGGCCCGGCGCTGTACTTGTCCAAGAAGCGCTGGCTCTACAGTTTCAGGC
AGTTCCTTCAAGCATCCGGCATCGCCCAGTCTGGGTCGGTCACCGTCATCGCTCACGCTCGCGTTCCGCTGGTCA
AGTTCGTGGATAAGGTCACGGGCCTCAAGGTGGACGTGTCGTTTGAGAACCTGGGAGGCGTGCAGGCGGTCGATA
CGTTCTTGGCCTGGAAGCGCGAATATCCCGAGATGCCGATTCTGGTGACGGTCATCAAGCACTTTTTGCTGATGC
GTGGTCTCAACGAGCCCGTCAGCGGCGGCATCGGCGGCTTCTCCGTCATCTGCCTCGTCGTCAGCATGTTGCAGA
TGATGCCGCCCACGCAGAGCAAGAGCCAGCAGGGCATCTACCACCTCGGCGATCTGCTTCTGTATTTCTTGGAGC
TCTATGGACGACGCTTCGAGTACCGGAACTTGGCCATTTCGCTGACGCGGCCCGTGGGATACATCAAAAAGGTGC
GGCGGCGGCTTCCTCGTCCCCGCGGCATGCTCTCTCGTGAAGTACTGACGCGGCTTGGGCAGTCCGAGGTGAAGA
GACTAACGTACAAGAACCCCAATCGGCTGTCCATCATCGACCCCAACAATCCGTCCAACGACATCTCGGGTGGAT
CGTCCAACACGACGGCCATCTTGGCTCGCTTCAACGACGCCTCTGTCGAGTTGCGCGAGAGGATGACGGAGGTGT
CGCAGCAGGCCGACAAGGGAAGCATCCTCGGTGTCATCCTCGAGGGTAACTACTCGAGCTTCAAGACGCAGCGAC
AGTACCTCAAGCAGGTCCACGAAGAGAAGCTGGGGCCGTGCTATAACCAGGAGAAGAAGCACATGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail