Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01658
Gene name
Locationscaffold_02:80649..81717
Strand+
Gene length (bp)1068
Transcript length (bp)924
Coding sequence length (bp)924
Protein length (aa) 308

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 2.5E-57 63 275
PF20434 BD-FAE BD-FAE 1.5E-13 60 155
PF07224 Chlorophyllase Chlorophyllase 1.2E-04 36 164

GO

GO Term Description Terminal node
GO:0015996 chlorophyll catabolic process Yes
GO:0016787 hydrolase activity Yes
GO:0047746 chlorophyllase activity Yes
GO:0009056 catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0046700 heterocycle catabolic process No
GO:0006787 porphyrin-containing compound catabolic process No
GO:0009987 cellular process No
GO:0033013 tetrapyrrole metabolic process No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0006778 porphyrin-containing compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0044248 cellular catabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0015994 chlorophyll metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:1901575 organic substance catabolic process No
GO:0008150 biological_process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0042440 pigment metabolic process No
GO:0033015 tetrapyrrole catabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046149 pigment catabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6405 0.5148 0.0556 0.0162 0.1192 0.116 0.1387 0.225 0.2172 0.1532

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.34 0.00 0.86
Alive In ants, during behavior modification 24.79 10.50 39.08
Dead In ants, recently dead 14.65 5.34 23.96

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000851 yes
Alive Dead 0.018853 yes
Dead Fungus 0.000851 yes

Orthologs

Orthofinder run ID4
Orthogroup3034
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7051
Ophiocordyceps australis map64 (Brazil) OphauB2|4574
Ophiocordyceps camponoti-floridani Ophcf2|01658 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1301
Ophiocordyceps kimflemingae Ophio5|3691
Ophiocordyceps subramaniannii Hirsu2|5241

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01658
MHLVPLSQARSIGGKFVPGAGPEQPVGRTVEASVPRTVSTGPPIPVRCLVPEGEPPEGGWPALLYFHGGGWVFGD
LDTENVGATHLCSRSACVVACVDYRLALKTLPAAVDDAWEASLWLSTEAQTLLPINTTRLAVGGSSAGGNLAAVI
AQRASATPSSNLVFQLQLLLVPVIDNTASTATSSTYAANEHAPGLSVAKMLWYRDHYLPRVEDWAHPEASPLLWE
GDWASLPPAVVVLAGVDPLRDEGERFASRLEGAGVRVELRVFEGQPHPFISMDGVLEDGRRGLIWASDAVRDVLY
PSGEEGE*
Coding >Ophcf2|01658
ATGCACCTCGTCCCCCTCTCCCAAGCCCGGTCCATCGGCGGCAAATTCGTCCCCGGCGCCGGACCCGAGCAGCCC
GTCGGCCGCACCGTCGAAGCCTCCGTCCCGCGAACCGTCTCTACCGGCCCGCCGATCCCCGTCCGCTGCCTCGTG
CCCGAAGGCGAGCCTCCCGAGGGCGGATGGCCGGCGCTGCTGTACTTTCACGGCGGTGGTTGGGTTTTCGGCGAT
CTGGATACGGAGAATGTCGGGGCTACTCATTTGTGTTCGAGGTCGGCCTGCGTCGTTGCATGTGTCGATTACCGC
CTCGCCCTGAAGACCCTTCCCGCCGCCGTAGACGACGCCTGGGAAGCATCCCTCTGGCTCTCGACAGAGGCCCAA
ACCCTCCTCCCCATAAACACCACCCGCCTGGCCGTAGGCGGCTCATCCGCAGGCGGCAACCTCGCCGCCGTCATC
GCCCAACGCGCCTCGGCGACCCCGTCCTCCAACCTCGTCTTCCAGCTACAGCTCCTCCTCGTCCCCGTAATCGAC
AACACGGCCTCGACCGCCACCAGCTCGACCTACGCCGCCAACGAGCACGCTCCGGGCCTCAGCGTCGCAAAGATG
CTATGGTACCGCGACCATTACCTCCCCCGTGTCGAGGACTGGGCTCATCCCGAGGCCAGTCCCTTGCTTTGGGAG
GGCGATTGGGCTTCATTGCCGCCTGCCGTCGTCGTCCTCGCCGGCGTTGATCCTCTGCGAGATGAGGGGGAGCGA
TTCGCTTCTCGTCTCGAGGGGGCGGGTGTGCGTGTCGAGCTCAGGGTGTTTGAGGGCCAGCCACATCCGTTCATT
TCCATGGATGGCGTGCTAGAGGATGGCCGTCGGGGCCTGATCTGGGCCTCTGATGCCGTGAGGGATGTCCTATAC
CCATCGGGCGAAGAAGGAGAGTGA
Transcript >Ophcf2|01658
ATGCACCTCGTCCCCCTCTCCCAAGCCCGGTCCATCGGCGGCAAATTCGTCCCCGGCGCCGGACCCGAGCAGCCC
GTCGGCCGCACCGTCGAAGCCTCCGTCCCGCGAACCGTCTCTACCGGCCCGCCGATCCCCGTCCGCTGCCTCGTG
CCCGAAGGCGAGCCTCCCGAGGGCGGATGGCCGGCGCTGCTGTACTTTCACGGCGGTGGTTGGGTTTTCGGCGAT
CTGGATACGGAGAATGTCGGGGCTACTCATTTGTGTTCGAGGTCGGCCTGCGTCGTTGCATGTGTCGATTACCGC
CTCGCCCTGAAGACCCTTCCCGCCGCCGTAGACGACGCCTGGGAAGCATCCCTCTGGCTCTCGACAGAGGCCCAA
ACCCTCCTCCCCATAAACACCACCCGCCTGGCCGTAGGCGGCTCATCCGCAGGCGGCAACCTCGCCGCCGTCATC
GCCCAACGCGCCTCGGCGACCCCGTCCTCCAACCTCGTCTTCCAGCTACAGCTCCTCCTCGTCCCCGTAATCGAC
AACACGGCCTCGACCGCCACCAGCTCGACCTACGCCGCCAACGAGCACGCTCCGGGCCTCAGCGTCGCAAAGATG
CTATGGTACCGCGACCATTACCTCCCCCGTGTCGAGGACTGGGCTCATCCCGAGGCCAGTCCCTTGCTTTGGGAG
GGCGATTGGGCTTCATTGCCGCCTGCCGTCGTCGTCCTCGCCGGCGTTGATCCTCTGCGAGATGAGGGGGAGCGA
TTCGCTTCTCGTCTCGAGGGGGCGGGTGTGCGTGTCGAGCTCAGGGTGTTTGAGGGCCAGCCACATCCGTTCATT
TCCATGGATGGCGTGCTAGAGGATGGCCGTCGGGGCCTGATCTGGGCCTCTGATGCCGTGAGGGATGTCCTATAC
CCATCGGGCGAAGAAGGAGAGTGA
Gene >Ophcf2|01658
ATGCACCTCGTCCCCCTCTCCCAAGCCCGGTCCATCGGCGGCAAATTCGTCCCCGGCGCCGGACCCGAGCAGCCC
GTCGGCCGCACCGTCGAAGCCTCCGTCCCGCGAACCGTCTCTACCGGCCCGCCGATCCCCGTCCGCTGCCTCGTG
CCCGAAGGCGAGCCTCCCGAGGGCGGATGGCCGGCGCTGCTGTACTTTCACGGCGGTGGTTGGGTTTTCGGCGAT
CTGGATACGGAGAATGTCGGGGCTACTCATTTGTGTTCGAGGTCGGCCTGCGTCGTTGCATGTGTCGATTACCGG
TGAGCTTCTCTTCTTCCTCTCTACCCTGTATCTTCTTCCTCTTCACGTCATCTCTTCCTCACTTATACCACTCTT
CCCTCACCTACATAACACCCAACCTACGTACATACACAGTTGCCCTCTCACTAAACCCCCCCTTTCAGCCTCGCC
CTGAAGACCCTTCCCGCCGCCGTAGACGACGCCTGGGAAGCATCCCTCTGGCTCTCGACAGAGGCCCAAACCCTC
CTCCCCATAAACACCACCCGCCTGGCCGTAGGCGGCTCATCCGCAGGCGGCAACCTCGCCGCCGTCATCGCCCAA
CGCGCCTCGGCGACCCCGTCCTCCAACCTCGTCTTCCAGCTACAGCTCCTCCTCGTCCCCGTAATCGACAACACG
GCCTCGACCGCCACCAGCTCGACCTACGCCGCCAACGAGCACGCTCCGGGCCTCAGCGTCGCAAAGATGCTATGG
TACCGCGACCATTACCTCCCCCGTGTCGAGGACTGGGCTCATCCCGAGGCCAGTCCCTTGCTTTGGGAGGGCGAT
TGGGCTTCATTGCCGCCTGCCGTCGTCGTCCTCGCCGGCGTTGATCCTCTGCGAGATGAGGGGGAGCGATTCGCT
TCTCGTCTCGAGGGGGCGGGTGTGCGTGTCGAGCTCAGGGTGTTTGAGGGCCAGCCACATCCGTTCATTTCCATG
GATGGCGTGCTAGAGGATGGCCGTCGGGGCCTGATCTGGGCCTCTGATGCCGTGAGGGATGTCCTATACCCATCG
GGCGAAGAAGGAGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail