Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01641
Gene name
Locationscaffold_01:5582648..5583254
Strand-
Gene length (bp)606
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09135 Alb1 Alb1 3.3E-25 9 113

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1397 0.908 0.0082 0.0158 0.197 0.0047 0.0327 0.0046 0.0055 0.0058

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5432
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|6854
Ophiocordyceps camponoti-floridani Ophcf2|01641 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2822
Ophiocordyceps kimflemingae Ophio5|1802
Ophiocordyceps subramaniannii Hirsu2|5932

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01641
MAKNRVPSKHSRAARRATSPSINTDKSLKEVTLPRDVASRPSVLAIRQSAGVQKKTRLPRKSRMSTKARRRHDKG
LEMAEAVGERTAAKTRRSVGRARVARDRRKPWDDVNKAARVDDSDDQVRAGREGRGPMDADDDSDQEMDNDDGEA
SAIDGQQQQQQQPQQAVNETQHRVDEDEIL*
Coding >Ophcf2|01641
ATGGCCAAGAACAGAGTACCATCCAAACACTCGCGAGCTGCGCGACGGGCAACGTCGCCGAGCATCAACACGGAC
AAGTCGCTAAAGGAGGTGACACTGCCCCGCGACGTCGCCTCCCGCCCCTCCGTTCTAGCAATCCGCCAATCCGCT
GGCGTGCAGAAGAAGACAAGGCTGCCGCGAAAGAGCCGCATGTCGACAAAGGCACGCCGCCGGCACGACAAGGGT
CTCGAGATGGCCGAGGCCGTTGGCGAACGCACCGCCGCCAAGACGCGACGAAGCGTCGGGAGGGCTCGCGTCGCT
CGTGATCGTCGTAAGCCGTGGGACGATGTCAACAAAGCTGCCAGAGTGGATGACAGCGATGACCAAGTTCGCGCT
GGGAGAGAAGGGAGGGGGCCGATGGACGCGGACGATGATTCAGACCAGGAAATGGACAACGATGACGGAGAAGCC
TCAGCCATTGATGGGCAGCAGCAGCAGCAGCAGCAGCCGCAACAGGCCGTCAATGAGACTCAGCACAGAGTCGAC
GAGGACGAGATCCTTTGA
Transcript >Ophcf2|01641
ATGGCCAAGAACAGAGTACCATCCAAACACTCGCGAGCTGCGCGACGGGCAACGTCGCCGAGCATCAACACGGAC
AAGTCGCTAAAGGAGGTGACACTGCCCCGCGACGTCGCCTCCCGCCCCTCCGTTCTAGCAATCCGCCAATCCGCT
GGCGTGCAGAAGAAGACAAGGCTGCCGCGAAAGAGCCGCATGTCGACAAAGGCACGCCGCCGGCACGACAAGGGT
CTCGAGATGGCCGAGGCCGTTGGCGAACGCACCGCCGCCAAGACGCGACGAAGCGTCGGGAGGGCTCGCGTCGCT
CGTGATCGTCGTAAGCCGTGGGACGATGTCAACAAAGCTGCCAGAGTGGATGACAGCGATGACCAAGTTCGCGCT
GGGAGAGAAGGGAGGGGGCCGATGGACGCGGACGATGATTCAGACCAGGAAATGGACAACGATGACGGAGAAGCC
TCAGCCATTGATGGGCAGCAGCAGCAGCAGCAGCAGCCGCAACAGGCCGTCAATGAGACTCAGCACAGAGTCGAC
GAGGACGAGATCCTTTGA
Gene >Ophcf2|01641
ATGGCCAAGAACAGAGGTTCGTATCTACGCAAGAATCATCACTGCGCTGTGACACATAACTCACCCGCGTTCTTT
CCAGTACCATCCAAACACTCGCGAGCTGCGCGACGGGCAACGTCGCCGAGCATCAACACGGACAAGTCGCTAAAG
GAGGTGACACTGCCCCGCGACGTCGCCTCCCGCCCCTCCGTTCTAGCAATCCGCCAATCCGCTGGCGTGCAGAAG
AAGACAAGGCTGCCGCGAAAGAGCCGCATGTCGACAAAGGCACGCCGCCGGCACGACAAGGGTCTCGAGATGGCC
GAGGCCGTTGGCGAACGCACCGCCGCCAAGACGCGACGAAGCGTCGGGAGGGCTCGCGTCGCTCGTGATCGTCGT
AAGCCGTGGGACGATGTCAACAAAGCTGCCAGAGTGGATGACAGCGATGACCAAGTTCGCGCTGGGAGAGAAGGG
AGGGGGCCGATGGACGCGGACGATGATTCAGACCAGGAAATGGACAACGATGACGGAGAAGCCTCAGCCATTGAT
GGGCAGCAGCAGCAGCAGCAGCAGCCGCAACAGGCCGTCAATGAGACTCAGCACAGAGTCGACGAGGACGAGATC
CTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail