Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01631
Gene name
Locationscaffold_01:5563787..5564230
Strand+
Gene length (bp)443
Transcript length (bp)327
Coding sequence length (bp)327
Protein length (aa) 109

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08661 Rep_fac-A_3 Replication factor A protein 3 7.6E-21 1 104

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0005634 nucleus Yes
GO:0006281 DNA repair Yes
GO:0006310 DNA recombination Yes
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0051716 cellular response to stimulus No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0008152 metabolic process No
GO:0050896 response to stimulus No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0033554 cellular response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006950 response to stress No
GO:0008150 biological_process No
GO:0043226 organelle No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6803 0.5477 0.0492 0.1306 0.106 0.122 0.0261 0.1479 0.0149 0.0668

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3259
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5246
Ophiocordyceps australis map64 (Brazil) OphauB2|6846
Ophiocordyceps camponoti-floridani Ophcf2|01631 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2898
Ophiocordyceps kimflemingae Ophio5|7438
Ophiocordyceps subramaniannii Hirsu2|5921

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01631
MSEQMCAPRVTATYLNTSVGRLVTIVGKVTQIRGDQAVLEADGAVNVALNHDSNLTNGNAAQIIGKVNPDLSVKA
LSSRDLGAGVDYNLCSAVVEATHRHKDIFISGT*
Coding >Ophcf2|01631
ATGTCCGAGCAAATGTGCGCGCCACGCGTCACGGCAACCTACCTCAATACCTCCGTCGGTCGCCTCGTTACCATC
GTTGGCAAGGTCACGCAAATCCGCGGCGACCAAGCCGTTCTCGAAGCCGACGGAGCAGTCAACGTCGCCCTAAAT
CATGACTCTAATCTGACCAACGGTAACGCGGCGCAAATCATTGGAAAGGTCAATCCGGACCTGTCCGTAAAGGCC
CTGAGTTCAAGAGACCTAGGCGCCGGCGTTGACTACAACCTATGTTCCGCCGTTGTCGAGGCCACCCACCGGCAC
AAGGATATCTTCATCTCCGGCACATGA
Transcript >Ophcf2|01631
ATGTCCGAGCAAATGTGCGCGCCACGCGTCACGGCAACCTACCTCAATACCTCCGTCGGTCGCCTCGTTACCATC
GTTGGCAAGGTCACGCAAATCCGCGGCGACCAAGCCGTTCTCGAAGCCGACGGAGCAGTCAACGTCGCCCTAAAT
CATGACTCTAATCTGACCAACGGTAACGCGGCGCAAATCATTGGAAAGGTCAATCCGGACCTGTCCGTAAAGGCC
CTGAGTTCAAGAGACCTAGGCGCCGGCGTTGACTACAACCTATGTTCCGCCGTTGTCGAGGCCACCCACCGGCAC
AAGGATATCTTCATCTCCGGCACATGA
Gene >Ophcf2|01631
ATGTCCGAGCAAATGTGCGCGCCACGCGTCACGGCAACCTACCTCAATACCTCCGTCGGTCGCCTCGTTACCATC
GTTGGCAAGGTCACGCAAATCCGCGGCGACCAAGCCGTTCTCGAAGCCGACGGAGCAGTCAACGTCGCCCTAAAT
CATGCAAGTTATCTTTCCGAAGCCCATTCATCTATGTCGTTCCCCACGAATGACAAGTCTTTCCTAGGACTCTAA
TCTGACCAACGGTAACGCGGCGCAAATCATTGGAAAGGTCAATCCGGACCTGTCCGTAAAGGCCCTGAGTTCAAG
AGACCTAGGCGCCGGCGTTGGTGAGCACCCGTCCTACCCCCCCTAAGCCCAAGATGCTGATATTTCCCGCAGACT
ACAACCTATGTTCCGCCGTTGTCGAGGCCACCCACCGGCACAAGGATATCTTCATCTCCGGCACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail