Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01629
Gene name
Locationscaffold_01:5559820..5561360
Strand+
Gene length (bp)1540
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01161 PBP Phosphatidylethanolamine-binding protein 1.8E-08 281 375

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1221 0.2146 0.1051 0.0552 0.8258 0.0223 0.0455 0.0267 0.032 0.0185

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3257
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3905
Ophiocordyceps australis map64 (Brazil) OphauB2|6844
Ophiocordyceps camponoti-floridani Ophcf2|01629 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2900
Ophiocordyceps kimflemingae Ophio5|1753
Ophiocordyceps subramaniannii Hirsu2|5917

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01629
MSRLRHVVRPLVGLPLRLRPDVIVPRRLESSVAGPPPPPYQPPEVPPPSTPAAPSSAASPPPPPGSSGSASPPSP
ASSGAARYPIPAPTAADLDPNTVLPRFEKDLMDKGLQPIGSRRRRVAIRSPGNDIPFEQLPYQTFQEALKIIAAD
RLEKIERIRIETAKIARLEQRDPETVNGGQRGKDRRLKDLRKEVEDLKILADINDPLVKKRFEDGLGDMNKPIYR
YYTRQKWLSYDYKLIVQRIEQFHIVPDLVDKLEPTIDVKLLFRGQKISPGSIVPSNVSENMPLLRVQLFDRGERL
FTVVVVDADVPDVSKDCYWKRCHFLAANIPLNPCNTSLPFSKMDKDKIALPWLPPTSQKGAPYHRLAIFLLEQVD
NEMFDVAKMREVYSSRDHFCVKVLRQKYKLLPKGFNMFRSVWDDTTAEVMQRHNIPGADVELRRVHIPSIKPYKG
PRGWEAKRQGPKYRHLWHRTRRIKGLSSGRGWTKRR*
Coding >Ophcf2|01629
ATGTCGCGGTTACGGCATGTGGTCCGACCGCTTGTCGGACTGCCGCTGCGTCTGCGTCCGGACGTAATTGTCCCG
CGGCGTCTTGAAAGCAGCGTCGCCGGTCCTCCTCCGCCGCCGTATCAGCCTCCGGAGGTCCCTCCGCCTTCTACT
CCTGCAGCCCCGTCATCGGCGGCGTCTCCTCCTCCACCGCCGGGCTCATCGGGATCTGCATCGCCTCCATCGCCA
GCCTCATCCGGCGCCGCTAGGTATCCCATCCCGGCCCCGACCGCCGCCGACCTCGACCCCAACACCGTCCTCCCC
CGCTTCGAAAAGGACCTCATGGATAAAGGGTTACAGCCCATCGGCTCGAGGCGTCGGCGCGTCGCCATCCGCTCT
CCTGGCAATGACATTCCCTTCGAGCAGCTGCCCTACCAGACCTTCCAGGAGGCGCTCAAGATCATAGCCGCCGAC
CGTCTTGAAAAGATAGAACGCATACGCATCGAGACGGCCAAGATTGCTCGTCTCGAGCAAAGGGATCCGGAGACT
GTCAATGGCGGTCAGAGGGGGAAGGATCGGCGGCTGAAGGATTTGCGCAAGGAGGTTGAGGACCTCAAGATTCTG
GCCGATATCAACGACCCGCTGGTCAAGAAGAGGTTCGAAGATGGACTTGGTGATATGAACAAGCCCATCTACCGC
TACTATACCCGCCAAAAGTGGCTCAGCTACGACTACAAGCTCATCGTGCAGCGTATCGAGCAGTTTCACATCGTC
CCCGACCTTGTCGACAAGTTGGAGCCCACCATCGACGTCAAGCTCCTCTTCCGCGGCCAGAAGATCTCTCCCGGC
AGCATCGTTCCCAGCAACGTCAGCGAGAACATGCCCCTGCTGCGGGTTCAGCTCTTCGATCGGGGCGAGCGCCTC
TTCACCGTCGTCGTCGTCGACGCCGATGTCCCGGACGTCTCCAAAGATTGTTACTGGAAGCGCTGCCACTTCCTC
GCTGCCAACATCCCCCTCAACCCTTGCAACACTTCCTTACCGTTTTCTAAAATGGACAAGGATAAGATTGCGCTG
CCCTGGCTGCCGCCAACGTCGCAAAAGGGAGCTCCCTACCACCGTCTCGCCATCTTCCTGCTGGAGCAGGTGGAT
AACGAAATGTTCGACGTAGCCAAGATGCGCGAAGTGTACTCGAGCCGCGACCACTTCTGCGTCAAGGTCCTCCGC
CAAAAATACAAACTCCTCCCCAAGGGTTTCAACATGTTCCGCTCGGTTTGGGACGACACGACGGCCGAAGTGATG
CAACGGCACAACATCCCAGGCGCCGACGTCGAGCTTCGTCGCGTCCATATCCCGAGCATAAAGCCTTACAAGGGT
CCCCGCGGCTGGGAGGCCAAACGGCAGGGTCCCAAGTACCGCCACTTGTGGCATCGCACGCGCCGCATCAAGGGT
CTGTCCTCCGGCAGGGGCTGGACCAAGAGGCGGTAA
Transcript >Ophcf2|01629
ATGTCGCGGTTACGGCATGTGGTCCGACCGCTTGTCGGACTGCCGCTGCGTCTGCGTCCGGACGTAATTGTCCCG
CGGCGTCTTGAAAGCAGCGTCGCCGGTCCTCCTCCGCCGCCGTATCAGCCTCCGGAGGTCCCTCCGCCTTCTACT
CCTGCAGCCCCGTCATCGGCGGCGTCTCCTCCTCCACCGCCGGGCTCATCGGGATCTGCATCGCCTCCATCGCCA
GCCTCATCCGGCGCCGCTAGGTATCCCATCCCGGCCCCGACCGCCGCCGACCTCGACCCCAACACCGTCCTCCCC
CGCTTCGAAAAGGACCTCATGGATAAAGGGTTACAGCCCATCGGCTCGAGGCGTCGGCGCGTCGCCATCCGCTCT
CCTGGCAATGACATTCCCTTCGAGCAGCTGCCCTACCAGACCTTCCAGGAGGCGCTCAAGATCATAGCCGCCGAC
CGTCTTGAAAAGATAGAACGCATACGCATCGAGACGGCCAAGATTGCTCGTCTCGAGCAAAGGGATCCGGAGACT
GTCAATGGCGGTCAGAGGGGGAAGGATCGGCGGCTGAAGGATTTGCGCAAGGAGGTTGAGGACCTCAAGATTCTG
GCCGATATCAACGACCCGCTGGTCAAGAAGAGGTTCGAAGATGGACTTGGTGATATGAACAAGCCCATCTACCGC
TACTATACCCGCCAAAAGTGGCTCAGCTACGACTACAAGCTCATCGTGCAGCGTATCGAGCAGTTTCACATCGTC
CCCGACCTTGTCGACAAGTTGGAGCCCACCATCGACGTCAAGCTCCTCTTCCGCGGCCAGAAGATCTCTCCCGGC
AGCATCGTTCCCAGCAACGTCAGCGAGAACATGCCCCTGCTGCGGGTTCAGCTCTTCGATCGGGGCGAGCGCCTC
TTCACCGTCGTCGTCGTCGACGCCGATGTCCCGGACGTCTCCAAAGATTGTTACTGGAAGCGCTGCCACTTCCTC
GCTGCCAACATCCCCCTCAACCCTTGCAACACTTCCTTACCGTTTTCTAAAATGGACAAGGATAAGATTGCGCTG
CCCTGGCTGCCGCCAACGTCGCAAAAGGGAGCTCCCTACCACCGTCTCGCCATCTTCCTGCTGGAGCAGGTGGAT
AACGAAATGTTCGACGTAGCCAAGATGCGCGAAGTGTACTCGAGCCGCGACCACTTCTGCGTCAAGGTCCTCCGC
CAAAAATACAAACTCCTCCCCAAGGGTTTCAACATGTTCCGCTCGGTTTGGGACGACACGACGGCCGAAGTGATG
CAACGGCACAACATCCCAGGCGCCGACGTCGAGCTTCGTCGCGTCCATATCCCGAGCATAAAGCCTTACAAGGGT
CCCCGCGGCTGGGAGGCCAAACGGCAGGGTCCCAAGTACCGCCACTTGTGGCATCGCACGCGCCGCATCAAGGGT
CTGTCCTCCGGCAGGGGCTGGACCAAGAGGCGGTAA
Gene >Ophcf2|01629
ATGTCGCGGTTACGGCATGTGGTCCGACCGCTTGTCGGACTGCCGCTGCGTCTGCGTCCGGACGTAATTGTCCCG
CGGCGTCTTGAAAGCAGCGTCGCCGGTCCTCCTCCGCCGCCGTATCAGCCTCCGGAGGTCCCTCCGCCTTCTACT
CCTGCAGCCCCGTCATCGGCGGCGTCTCCTCCTCCACCGCCGGGCTCATCGGGATCTGCATCGCCTCCATCGCCA
GCCTCATCCGGCGCCGCTAGGTATCCCATCCCGGCCCCGACCGCCGCCGACCTCGACCCCAACACCGTCCTCCCC
CGCTTCGAAAAGGACCTCATGGATAAAGGGTTACAGCCCATCGGCTCGAGGCGTCGGCGCGTCGCCATCCGCTCT
CCTGGCAATGACATTCCCTTCGAGCAGCTGCCCTACCAGACCTTCCAGGAGGCGCTCAAGATCATAGCCGCCGAC
CGTCTTGAAAAGATAGAACGCATACGCATCGAGACGGCCAAGATTGCTCGTCTCGAGCAAAGGGATCCGGAGACT
GTCAATGGCGGTCAGAGGGGGAAGGATCGGCGGCTGAAGGATTTGCGCAAGGAGGTTGAGGACCTCAAGATTCTG
GCCGATATCAACGACCCGCTGGTCAAGAAGAGGTTCGAAGATGGACTTGGTGAGGATCCTTATTGCATATCTTCC
ACCTCTTATTATATTTTAAACTAACCAAATTTCCCCCCCTTGTCCCCGAATAGGTGATATGAACAAGCCCATCTA
CCGCTACTATACCCGCCAAAAGTGGCTCAGCTACGACTACAAGCTCATCGTGCAGCGTATCGAGCAGTTTCACAT
CGTCCCCGACCTTGTCGACAAGTTGGAGCCCACCATCGACGTCAAGCTCCTCTTCCGCGGCCAGAAGATCTCTCC
CGGCAGCATCGTTCCCAGCAACGTCAGCGAGAACATGCCCCTGCTGCGGGTTCAGCTCTTCGATCGGGGCGAGCG
CCTCTTCACCGTCGTCGTCGTCGACGCCGATGTCCCGGACGTCTCCAAAGATTGTTACTGGAAGCGCTGCCACTT
CCTCGCTGCCAACATCCCCCTCAACCCTTGCAACACTTCCTTACCGTTTTCTAAAATGGACAAGGATAAGATTGC
GCTGCCCTGGCTGCCGCCAACGTCGCAAAAGGGAGCTCCCTACCACCGTCTCGCCATCTTCCTGCTGGAGCAGGT
GGATAACGAAATGTTCGACGTAGCCAAGATGCGCGAAGTGTACTCGAGCCGCGACCACTTCTGCGTCAAGGTCCT
CCGCCAAAAATACAAACTCCTCCCCAAGGGTTTCAACATGTTCCGCTCGGTTTGGGACGACACGACGGCCGAAGT
GATGCAACGGCACAACATCCCAGGCGCCGACGTCGAGCTTCGTCGCGTCCATATCCCGAGCATAAAGCCTTACAA
GGGTCCCCGCGGCTGGGAGGCCAAACGGCAGGGTCCCAAGTACCGCCACTTGTGGCATCGCACGCGCCGCATCAA
GGGTCTGTCCTCCGGCAGGGGCTGGACCAAGAGGCGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail