Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01625
Gene name
Locationscaffold_01:5551769..5555492
Strand+
Gene length (bp)3723
Transcript length (bp)3273
Coding sequence length (bp)3273
Protein length (aa) 1091

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02233 PNTB NAD(P) transhydrogenase beta subunit 8.5E-165 632 1082
PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain 3.3E-72 226 450
PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain 8.4E-48 86 222
PF12769 PNTB_4TM 4TM region of pyridine nucleotide transhydrogenase, mitoch 3.7E-29 513 597

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 505 527 22
2 539 561 22
3 565 587 22
4 604 623 19
5 628 650 22
6 657 679 22
7 683 702 19
8 715 737 22
9 747 769 22
10 790 812 22
11 832 854 22
12 861 883 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 8.57 4.24 12.89
Alive In ants, during behavior modification 7.65 3.64 11.65
Dead In ants, recently dead 9.03 4.51 13.56

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.657584 no
Alive Dead 0.427604 no
Dead Fungus 0.846218 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01625
MACSSLLVSGLRPASARLARRPLRAALLKLSRRWLSSPPRRSLVPIIPKPLALLRCAPTTHCSLPPVPYSTIAVP
LPRPYARLTVGVPAEVFPGERRVALTPANVALLLNKGYNRLIVQRGAGAAAGFLDEAYEKAGATIVDTADAVWSD
AHVVLKVRGPSAKEVQDIKENQVIISFLQPAQNQDLVRRIAERKATCFAMDMIPRISRAQVFDALSSMANIAGYK
AVLEASNVFGRFLTGQVTAAGKIPPCKVLVIGAGVAGLSAIATARRMGAIVRGFDTRPAAREQVQSLGAEFIEVD
IHEDGSGVGGYAKEMSDDFIRAEMKLFKEQAKDVDIIITTALIPGKPAPKLITKDMLDCMRPGSVVVDLAAEAGG
NCAATVAGELSKYNDVKIIGYTDLPSRLPTQSSTLYSNNITRFLMSLSPEDKQFGVNLSDEVVRGAIVTLDGHIL
PPAPRPTPPPPVAKPAAADASSLPQPPTPWQSKTREVAAVTAGMSSVLALGKFTGPLFMSNAFTFALASLIGYRV
VWGVVPALHSPLMSVTNAISGMVGVGGLFVLGGGYLPETVPQLFGAASVLLAFVNVSGGFVITKRMLDMFRRPTD
PPEYPWLYGIPALVFGGGFLAAASTGAAGLVQAGYLASTILCIGSISGLASQATARMGNMLGILGVGSGVLASLL
AVGFSPEVLTQFGGLATIGALAGFLIGKRITPTDLPQTVAALHSVVGLAAVLTSIGSVMANVADVSTLHMVTAYA
GVLVGGITFTGSIVAFLKLAGRMSSRPKLLPARHAINAGLLATNAATMGAFITMAPGSPAIAAGALAANAAMSFI
KGYTTTAAIGGADMPVVITVLNAYSGFALVAEGFMLGNPLLTSVGALIGVSGSILSYIMCVAMNRSLTNVLFGGL
STPTAVSKYEPEGAVTTTSVDELADSLLGAETVILVVGYGMAVAKAQYAISSIVSLLRSRGVKVRFAIHPVAGRM
PGQCNVLLAEASVPYDIVLEMDEINDDFAETDLTVVIGANDTVNPIALEKGSAIEGMPVLQAWKSKNVVVMKRSL
ASGYADVPNPMFYMPNTRMLFGDARASCEAIKTAVESKNR*
Coding >Ophcf2|01625
ATGGCTTGCTCCAGCTTGCTCGTCTCGGGCCTCCGCCCAGCGTCCGCCCGTCTCGCCCGTCGGCCTCTTCGAGCC
GCTCTGCTGAAGCTGTCTCGGAGATGGCTGAGCAGCCCCCCCCGTCGATCCCTCGTGCCCATCATCCCCAAGCCT
CTGGCTCTTCTCCGCTGCGCGCCGACGACGCACTGCAGCCTCCCGCCTGTGCCCTACTCGACCATCGCCGTTCCG
CTTCCTAGGCCCTATGCCCGTCTCACCGTCGGCGTCCCCGCTGAGGTGTTTCCCGGTGAGCGTCGTGTTGCCCTC
ACGCCCGCCAATGTCGCTCTCCTCCTCAACAAGGGTTACAATCGCCTCATCGTCCAGCGTGGCGCAGGCGCTGCT
GCTGGCTTCCTCGACGAGGCATACGAAAAGGCCGGTGCAACGATTGTTGATACAGCTGATGCCGTCTGGTCCGAC
GCTCATGTCGTCCTCAAGGTCCGCGGTCCATCCGCCAAAGAGGTCCAAGACATCAAGGAGAATCAAGTCATCATT
TCCTTCCTGCAACCGGCCCAGAACCAGGACCTCGTACGGCGCATCGCCGAGCGCAAAGCAACGTGCTTCGCAATG
GACATGATCCCTCGCATCTCGCGAGCCCAGGTCTTCGACGCCCTGAGTAGCATGGCCAATATTGCCGGATACAAG
GCTGTCCTGGAGGCCTCCAACGTATTCGGCCGCTTCCTGACGGGCCAGGTGACGGCCGCAGGCAAGATTCCCCCT
TGCAAGGTGCTCGTCATCGGCGCGGGCGTCGCTGGCCTCAGCGCCATCGCCACTGCTCGCCGCATGGGGGCCATT
GTCCGTGGCTTCGACACGAGGCCAGCAGCTCGAGAGCAAGTTCAATCCCTAGGTGCCGAGTTCATCGAGGTCGAC
ATTCACGAAGACGGCTCCGGCGTCGGTGGCTATGCCAAGGAGATGAGCGACGACTTCATCCGCGCCGAGATGAAG
CTATTCAAGGAGCAGGCCAAGGACGTCGACATCATCATCACCACGGCCCTCATCCCGGGCAAGCCTGCTCCTAAG
CTCATCACCAAGGACATGCTCGACTGCATGAGGCCTGGCAGCGTCGTCGTCGATCTGGCCGCCGAGGCCGGTGGA
AACTGCGCCGCCACCGTCGCGGGTGAGCTGTCCAAGTACAACGACGTCAAGATTATCGGATATACCGATCTGCCG
TCTCGTCTCCCCACGCAGTCATCGACGCTCTACTCCAACAACATCACCAGATTTCTGATGTCTTTGTCCCCCGAG
GATAAGCAGTTCGGAGTCAATCTCTCCGACGAGGTGGTCCGCGGCGCCATCGTGACACTCGACGGCCACATCCTC
CCGCCGGCTCCGCGTCCCACGCCACCGCCGCCGGTTGCCAAACCGGCCGCCGCCGACGCATCCTCCTTGCCCCAG
CCACCGACGCCGTGGCAGAGCAAGACGCGAGAGGTCGCCGCCGTTACGGCCGGAATGAGCAGCGTCCTGGCCCTG
GGCAAGTTCACCGGCCCGCTGTTCATGTCCAACGCCTTCACCTTTGCCCTCGCCAGTCTGATCGGATATCGTGTC
GTCTGGGGCGTCGTCCCGGCCCTACACTCGCCCCTCATGAGCGTCACCAATGCCATCTCGGGCATGGTCGGCGTG
GGAGGCCTCTTCGTCCTCGGCGGCGGTTATCTGCCGGAGACTGTGCCGCAGCTTTTTGGAGCGGCGAGTGTGCTG
TTGGCCTTTGTCAACGTCTCGGGAGGTTTCGTCATTACGAAGCGCATGCTGGACATGTTTAGGCGGCCGACTGAC
CCCCCCGAATATCCCTGGCTGTACGGGATTCCGGCCCTCGTCTTCGGAGGCGGATTTCTTGCTGCCGCCTCGACC
GGCGCGGCGGGACTCGTTCAGGCCGGCTATCTCGCCAGCACCATCCTCTGCATCGGCTCCATCTCCGGGCTCGCA
TCGCAGGCCACGGCCAGGATGGGAAACATGCTCGGCATCCTCGGCGTCGGCTCCGGCGTGTTGGCCAGCCTGTTA
GCCGTTGGATTCTCCCCGGAGGTGCTGACCCAGTTCGGCGGTCTTGCTACCATCGGCGCCCTCGCAGGTTTCTTG
ATCGGTAAACGTATCACGCCGACTGACCTGCCTCAGACTGTGGCGGCTTTGCACTCGGTCGTCGGCCTGGCGGCT
GTGCTGACCAGCATCGGGAGCGTCATGGCCAACGTGGCGGACGTGTCGACGCTTCATATGGTGACCGCCTACGCC
GGGGTCCTCGTCGGTGGCATAACCTTTACCGGATCCATCGTCGCCTTTCTCAAGCTGGCTGGGCGCATGTCGTCG
CGTCCGAAGTTGCTACCGGCACGACACGCCATCAACGCGGGCCTGCTGGCGACAAACGCGGCGACTATGGGTGCC
TTTATCACCATGGCGCCCGGTAGTCCCGCGATTGCGGCCGGGGCGCTGGCGGCCAACGCGGCGATGAGCTTCATC
AAGGGATATACGACGACGGCGGCCATCGGAGGCGCCGATATGCCCGTCGTCATCACCGTTCTCAATGCATACAGC
GGCTTCGCGCTCGTGGCCGAGGGTTTCATGCTCGGGAACCCGCTGCTCACGTCGGTCGGGGCCCTCATCGGCGTA
TCCGGCTCGATTCTGTCATACATCATGTGCGTCGCCATGAACCGATCGCTTACCAACGTTCTCTTCGGCGGCCTG
TCGACGCCGACGGCCGTCAGCAAGTACGAGCCCGAGGGCGCCGTAACGACGACGTCGGTCGACGAACTGGCCGAC
TCGCTGCTTGGCGCCGAGACGGTGATACTAGTCGTGGGCTACGGCATGGCCGTGGCCAAGGCGCAGTACGCAATC
TCGAGCATTGTATCGCTGCTGCGGTCCAGGGGCGTCAAGGTGCGCTTCGCCATACACCCGGTGGCTGGCCGCATG
CCGGGGCAGTGCAACGTGCTACTCGCCGAGGCCAGCGTGCCGTACGACATTGTGCTGGAGATGGACGAGATCAAC
GATGACTTTGCGGAGACGGACCTGACTGTTGTCATTGGCGCCAACGACACGGTCAACCCCATCGCGCTCGAGAAG
GGGAGTGCCATCGAGGGAATGCCTGTTCTTCAGGCGTGGAAGAGCAAGAACGTCGTCGTCATGAAGCGGAGCCTG
GCCAGCGGCTATGCCGATGTGCCGAACCCCATGTTTTACATGCCCAATACGCGGATGCTCTTTGGCGACGCGCGG
GCAAGCTGCGAAGCCATCAAGACCGCAGTCGAGTCTAAGAATCGGTAG
Transcript >Ophcf2|01625
ATGGCTTGCTCCAGCTTGCTCGTCTCGGGCCTCCGCCCAGCGTCCGCCCGTCTCGCCCGTCGGCCTCTTCGAGCC
GCTCTGCTGAAGCTGTCTCGGAGATGGCTGAGCAGCCCCCCCCGTCGATCCCTCGTGCCCATCATCCCCAAGCCT
CTGGCTCTTCTCCGCTGCGCGCCGACGACGCACTGCAGCCTCCCGCCTGTGCCCTACTCGACCATCGCCGTTCCG
CTTCCTAGGCCCTATGCCCGTCTCACCGTCGGCGTCCCCGCTGAGGTGTTTCCCGGTGAGCGTCGTGTTGCCCTC
ACGCCCGCCAATGTCGCTCTCCTCCTCAACAAGGGTTACAATCGCCTCATCGTCCAGCGTGGCGCAGGCGCTGCT
GCTGGCTTCCTCGACGAGGCATACGAAAAGGCCGGTGCAACGATTGTTGATACAGCTGATGCCGTCTGGTCCGAC
GCTCATGTCGTCCTCAAGGTCCGCGGTCCATCCGCCAAAGAGGTCCAAGACATCAAGGAGAATCAAGTCATCATT
TCCTTCCTGCAACCGGCCCAGAACCAGGACCTCGTACGGCGCATCGCCGAGCGCAAAGCAACGTGCTTCGCAATG
GACATGATCCCTCGCATCTCGCGAGCCCAGGTCTTCGACGCCCTGAGTAGCATGGCCAATATTGCCGGATACAAG
GCTGTCCTGGAGGCCTCCAACGTATTCGGCCGCTTCCTGACGGGCCAGGTGACGGCCGCAGGCAAGATTCCCCCT
TGCAAGGTGCTCGTCATCGGCGCGGGCGTCGCTGGCCTCAGCGCCATCGCCACTGCTCGCCGCATGGGGGCCATT
GTCCGTGGCTTCGACACGAGGCCAGCAGCTCGAGAGCAAGTTCAATCCCTAGGTGCCGAGTTCATCGAGGTCGAC
ATTCACGAAGACGGCTCCGGCGTCGGTGGCTATGCCAAGGAGATGAGCGACGACTTCATCCGCGCCGAGATGAAG
CTATTCAAGGAGCAGGCCAAGGACGTCGACATCATCATCACCACGGCCCTCATCCCGGGCAAGCCTGCTCCTAAG
CTCATCACCAAGGACATGCTCGACTGCATGAGGCCTGGCAGCGTCGTCGTCGATCTGGCCGCCGAGGCCGGTGGA
AACTGCGCCGCCACCGTCGCGGGTGAGCTGTCCAAGTACAACGACGTCAAGATTATCGGATATACCGATCTGCCG
TCTCGTCTCCCCACGCAGTCATCGACGCTCTACTCCAACAACATCACCAGATTTCTGATGTCTTTGTCCCCCGAG
GATAAGCAGTTCGGAGTCAATCTCTCCGACGAGGTGGTCCGCGGCGCCATCGTGACACTCGACGGCCACATCCTC
CCGCCGGCTCCGCGTCCCACGCCACCGCCGCCGGTTGCCAAACCGGCCGCCGCCGACGCATCCTCCTTGCCCCAG
CCACCGACGCCGTGGCAGAGCAAGACGCGAGAGGTCGCCGCCGTTACGGCCGGAATGAGCAGCGTCCTGGCCCTG
GGCAAGTTCACCGGCCCGCTGTTCATGTCCAACGCCTTCACCTTTGCCCTCGCCAGTCTGATCGGATATCGTGTC
GTCTGGGGCGTCGTCCCGGCCCTACACTCGCCCCTCATGAGCGTCACCAATGCCATCTCGGGCATGGTCGGCGTG
GGAGGCCTCTTCGTCCTCGGCGGCGGTTATCTGCCGGAGACTGTGCCGCAGCTTTTTGGAGCGGCGAGTGTGCTG
TTGGCCTTTGTCAACGTCTCGGGAGGTTTCGTCATTACGAAGCGCATGCTGGACATGTTTAGGCGGCCGACTGAC
CCCCCCGAATATCCCTGGCTGTACGGGATTCCGGCCCTCGTCTTCGGAGGCGGATTTCTTGCTGCCGCCTCGACC
GGCGCGGCGGGACTCGTTCAGGCCGGCTATCTCGCCAGCACCATCCTCTGCATCGGCTCCATCTCCGGGCTCGCA
TCGCAGGCCACGGCCAGGATGGGAAACATGCTCGGCATCCTCGGCGTCGGCTCCGGCGTGTTGGCCAGCCTGTTA
GCCGTTGGATTCTCCCCGGAGGTGCTGACCCAGTTCGGCGGTCTTGCTACCATCGGCGCCCTCGCAGGTTTCTTG
ATCGGTAAACGTATCACGCCGACTGACCTGCCTCAGACTGTGGCGGCTTTGCACTCGGTCGTCGGCCTGGCGGCT
GTGCTGACCAGCATCGGGAGCGTCATGGCCAACGTGGCGGACGTGTCGACGCTTCATATGGTGACCGCCTACGCC
GGGGTCCTCGTCGGTGGCATAACCTTTACCGGATCCATCGTCGCCTTTCTCAAGCTGGCTGGGCGCATGTCGTCG
CGTCCGAAGTTGCTACCGGCACGACACGCCATCAACGCGGGCCTGCTGGCGACAAACGCGGCGACTATGGGTGCC
TTTATCACCATGGCGCCCGGTAGTCCCGCGATTGCGGCCGGGGCGCTGGCGGCCAACGCGGCGATGAGCTTCATC
AAGGGATATACGACGACGGCGGCCATCGGAGGCGCCGATATGCCCGTCGTCATCACCGTTCTCAATGCATACAGC
GGCTTCGCGCTCGTGGCCGAGGGTTTCATGCTCGGGAACCCGCTGCTCACGTCGGTCGGGGCCCTCATCGGCGTA
TCCGGCTCGATTCTGTCATACATCATGTGCGTCGCCATGAACCGATCGCTTACCAACGTTCTCTTCGGCGGCCTG
TCGACGCCGACGGCCGTCAGCAAGTACGAGCCCGAGGGCGCCGTAACGACGACGTCGGTCGACGAACTGGCCGAC
TCGCTGCTTGGCGCCGAGACGGTGATACTAGTCGTGGGCTACGGCATGGCCGTGGCCAAGGCGCAGTACGCAATC
TCGAGCATTGTATCGCTGCTGCGGTCCAGGGGCGTCAAGGTGCGCTTCGCCATACACCCGGTGGCTGGCCGCATG
CCGGGGCAGTGCAACGTGCTACTCGCCGAGGCCAGCGTGCCGTACGACATTGTGCTGGAGATGGACGAGATCAAC
GATGACTTTGCGGAGACGGACCTGACTGTTGTCATTGGCGCCAACGACACGGTCAACCCCATCGCGCTCGAGAAG
GGGAGTGCCATCGAGGGAATGCCTGTTCTTCAGGCGTGGAAGAGCAAGAACGTCGTCGTCATGAAGCGGAGCCTG
GCCAGCGGCTATGCCGATGTGCCGAACCCCATGTTTTACATGCCCAATACGCGGATGCTCTTTGGCGACGCGCGG
GCAAGCTGCGAAGCCATCAAGACCGCAGTCGAGTCTAAGAATCGGTAG
Gene >Ophcf2|01625
ATGGCTTGCTCCAGCTTGCTCGTCTCGGGCCTCCGCCCAGCGTCCGCCCGTCTCGCCCGTCGGCCTCTTCGAGGT
GCGGCCGCTTCTGGTTGAAGAATCTCTGCTTTTGCTAATGATGTGCCCGCTATTCAGCCGCTCTGCTGAAGCTGT
CTCGGAGATGGCTGAGCAGCCCCCCCCGTCGATCCCTCGTGCCCATCATCCCCAAGCCTCTGGCTCTTCTCCGCT
GCGCGCCGACGACGCACTGCAGCCTCCCGCCTGTGCCCTACTCGACCATCGCCGTTCCGCTTCCTAGGCCCTATG
CCCGTCTCACCGTCGGCGTCCCCGCTGAGGTGTTTCCCGGTGAGCGTCGTGTTGCCCTCACGCCCGCCAATGTCG
CTCTCCTCCTCAACAAGGGTTACAATCGCCTCATCGTCCAGCGTGGCGCAGGCGCTGCTGCTGGCTTCCTCGACG
AGGCATACGAAAAGGCCGGTGCAACGATTGTTGATACAGCTGATGCCGTCTGGTCCGACGCTCATGTCGTCCTCA
AGGTCCGCGGTCCATCCGCCAAAGAGGTCCAAGACATCAAGGAGAATCAAGTCATCATTTCCTTCCTGCAACCGG
CCCAGAACCAGGACCTCGTACGGCGCATCGCCGAGCGCAAAGCAACGTGCTTCGCAATGGACATGATCCCTCGCA
TCTCGCGAGCCCAGGTCTTCGACGCCCTGAGTAGCATGGCCAATATTGCCGGATACAAGGCTGTCCTGGAGGCCT
CCAACGTATTCGGCCGCTTCCTGACGGGCCAGGTGACGGCCGCAGGCAAGATTCCCCCTTGCAAGGTGCTCGTCA
TCGGCGCGGGCGTCGCTGGCCTCAGCGCCATCGCCACTGCTCGCCGCATGGGGGCCATTGTCCGTGGCTTCGACA
CGAGGCCAGCAGCTCGAGAGCAAGTTCAATCCCTAGGTGCCGAGTTCATCGAGGTCGACATTCACGAAGACGGCT
CCGGCGTCGGTGGCTATGCCAAGGAGATGAGCGACGACTTCATCCGCGCCGAGATGAAGCTATTCAAGGAGCAGG
CCAAGGACGTCGACATCATCATCACCACGGCCCTCATCCCGGGCAAGCCTGCTCCTAAGCTCATCACCAAGGACA
TGCTCGACTGCATGAGGCCTGGCAGCGTCGTCGTCGATCTGGCCGCCGAGGCCGGTGGAAACTGCGCCGCCACCG
TCGCGGGTGAGCTGTCCAAGTACAACGACGTCAAGATTATCGGTAGGCCAAGATGAGCTCTGGCATGGTGATGAC
ACTTACACGCGGACCATCAGGATATACCGATCTGCCGTCTCGTCTCCCCACGCAGTCATCGACGCTCTACTCCAA
CAACATCACCAGATTTCTGATGTCTTTGTCCCCCGAGGATAAGCAGTTCGGAGTCAATCTCTCCGACGAGGTGGT
CCGCGGCGCCATCGTGACACTCGACGGCCACATCCTCCCGCCGGCTCCGCGTCCCACGCCACCGCCGCCGGTTGC
CAAACCGGCCGCCGCCGACGCATCCTCCTTGCCCCAGCCACCGACGCCGTGGCAGAGCAAGACGCGAGAGGTCGC
CGCCGTTACGGCCGGAATGAGCAGCGTCCTGGCCCTGGGCAAGTTCACCGGCCCGCTGTTCATGTCCAACGCCTT
CACCTTTGCCCTCGCCAGTCTGATCGGATATCGTGTCGTCTGGGGCGTCGTCCCGGCCCTACACTCGCCCCTCAT
GAGCGTCACCAATGCCATCTCGGGCATGGTCGGCGTGGGAGGCCTCTTCGTCCTCGGCGGCGGTTATCTGCCGGA
GACTGTGCCGCAGCTTTTTGGAGCGGCGAGTGTGCTGTTGGCCTTTGTCAACGTCTCGGGAGGTTTCGTCATTAC
GAAGCGCATGCTGGACATGTTTAGGCGTGAGCTCGACCTTGGCAAGATCATCATGGCGACCCGGCCCTGCTGACG
CGCCACGCAGGGCCGACTGACCCCCCCGAATATCCCTGGCTGTACGGGATTCCGGCCCTCGTCTTCGGAGGCGGA
TTTCTTGCTGCCGCCTCGACCGGCGCGGCGGGACTCGTTCAGGCCGGCTATCTCGCCAGCACCATCCTCTGCATC
GGCTCCATCTCCGGGCTCGCATCGCAGGCCACGGCCAGGATGGGAAACATGCTCGGCATCCTCGGCGTCGGCTCC
GGCGTGTTGGCCAGCCTGTTAGCCGTTGGATTCTCCCCGGAGGTGCTGACCCAGTTCGGCGGTCTTGCTACCATC
GGCGCCCTCGCAGGTAAAGGCTCTTCTCGAACAGCAGACGTGCGGCTTTGGCTCATGACGCTTTCCAGGTTTCTT
GATCGGTAAACGTATCACGCCGACTGACCTGCCTCAGACTGTGGCGGCTTTGCACTCGGTCGTCGGCCTGGCGGC
TGTGCTGACCAGCATCGGGAGCGTCATGGCCAACGTGGCGGACGTGTCGACGCTTCATATGGTGACCGCCTACGC
CGGGGTCCTCGTCGGTAATATTGACCCCTTTTACGCTGTCTCGCTGTTCATCGTCTCGGCTGACATGTGTCAAAG
GTGGCATAACCTTTACCGGATCCATCGTCGCCTTTCTCAAGCTGGCTGGGCGCATGTCGTCGCGTCCGAAGTTGC
TACCGGCACGACACGCCATCAACGCGGGCCTGCTGGCGACAAACGCGGCGACTATGGGTGCCTTTATCACCATGG
CGCCCGGTAGTCCCGCGATTGCGGCCGGGGCGCTGGCGGCCAACGCGGCGATGAGCTTCATCAAGGGATATACGA
CGACGGCGGCCATCGGAGGCGCCGATATGCGTGAGTCCATGTATGATTGTTCCCTCTTTGGCAGATGCTGACCAG
TCGCGCAACCAGCCGTCGTCATCACCGTTCTCAATGCATACAGCGGCTTCGCGCTCGTGGCCGAGGGTTTCATGC
TCGGGAACCCGCTGCTCACGTCGGTCGGGGCCCTCATCGGCGTATCCGGCTCGATTCTGTCATACATCATGTGCG
TCGCCATGAACCGATCGCTTACCAACGTTCTCTTCGGCGGCCTGTCGACGCCGACGGCCGTCAGCAAGTACGAGC
CCGAGGGCGCCGTAACGACGACGTCGGTCGACGAACTGGCCGACTCGCTGCTTGGCGCCGAGACGGTGATACTAG
TCGTGGGCTACGGCATGGCCGTGGCCAAGGCGCAGTACGCAATCTCGAGCATTGTATCGCTGCTGCGGTCCAGGG
GCGTCAAGGTGCGCTTCGCCATACACCCGGTGGCTGGCCGCATGCCGGGGCAGTGCAACGTGCTACTCGCCGAGG
CCAGCGTGCCGTACGACATTGTGCTGGAGATGGACGAGATCAACGATGACTTTGCGGAGACGGACCTGACTGTTG
TCATTGGCGCCAACGACACGGTCAACCCCATCGCGCTCGAGAAGGGGAGTGCCATCGAGGGAATGCCTGTTCTTC
AGGCGTGGAAGAGCAAGAACGTCGTCGTCATGAAGCGGAGCCTGGCCAGCGGCTATGGTGAGTTTTGAATCAAGG
GATTTCTTCATGAAACGAAGAGAGGGCTGACTTGGTGCAGCCGATGTGCCGAACCCCATGTTTTACATGCCCAAT
ACGCGGATGCTCTTTGGCGACGCGCGGGCAAGCTGCGAAGGTGAGTGGCGGGTACGTTTACGAGCAGGGATAAGC
TGACATTGCATAGCCATCAAGACCGCAGTCGAGTCTAAGAATCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail