Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01616
Gene name
Locationscaffold_01:5533000..5533915
Strand+
Gene length (bp)915
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00551 Formyl_trans_N Formyl transferase 3.1E-37 93 284
PF01842 ACT ACT domain 7.1E-12 11 75
PF13740 ACT_6 ACT domain 4.4E-07 12 81

GO

GO Term Description Terminal node
GO:0016742 hydroxymethyl-, formyl- and related transferase activity Yes
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.7832 0.5712 0.0738 0.1139 0.5686 0.0528 0.0341 0.0374 0.052 0.0497

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2755
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4747
Ophiocordyceps australis map64 (Brazil) OphauB2|4067
Ophiocordyceps camponoti-floridani Ophcf2|01616 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|268
Ophiocordyceps kimflemingae Ophio5|3107
Ophiocordyceps subramaniannii Hirsu2|4366

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01616
MKTPNKMDKNHILTLSCPDRPGIIHAVTALLARHQLNIVDMRQFSDPTSHRFFMRLLIGPATDTAHLAEPLRKLA
DEFGMDPVRLRPATHRIRTLVMVSHIGHCLNDLVFRAASSDTQLPIEIVAVCSNHTEHEALARSNGVPFHHLPIT
IDEEENATDPASAREKAKAQQEERVLSLVKTLDAELVVLARYMQVLSPKLCAALSGRIINIHHSFLPSFKGARPY
HQAYERGVKIIGATAHFVTASLDEGPIIEQRVARVDHASTPRELADRGSDIECHVLAAAVRWYAEGRVFLNGTKT
VVFD*
Coding >Ophcf2|01616
ATGAAAACACCCAACAAAATGGACAAGAACCACATCCTAACCCTCTCCTGCCCCGACCGTCCCGGCATAATCCAC
GCCGTAACCGCCCTCCTCGCACGCCACCAGCTCAACATCGTCGACATGCGCCAGTTCAGCGACCCGACCTCGCAC
CGCTTCTTCATGCGTCTCCTCATCGGCCCGGCCACCGACACGGCTCACCTCGCGGAGCCCCTTCGCAAACTGGCG
GACGAGTTCGGCATGGATCCCGTTAGGCTTCGGCCCGCGACGCATCGGATAAGGACGCTCGTCATGGTTTCCCAC
ATAGGGCATTGTCTTAATGATCTTGTCTTCCGGGCGGCGTCTTCGGACACACAGCTCCCCATTGAAATCGTGGCC
GTCTGCTCCAACCACACCGAACACGAAGCTCTGGCTCGAAGCAACGGCGTTCCCTTCCACCACCTCCCCATCACC
ATCGACGAAGAAGAAAATGCCACCGATCCAGCCTCCGCCCGCGAAAAGGCAAAGGCCCAACAAGAAGAACGAGTC
CTCTCCCTCGTCAAAACCCTAGACGCCGAACTCGTCGTCCTCGCCCGCTACATGCAAGTCCTCTCACCCAAACTC
TGCGCCGCTCTCTCCGGCCGCATCATCAACATCCACCACTCCTTCCTCCCCTCCTTCAAGGGCGCCAGGCCCTAT
CACCAGGCGTACGAGCGGGGCGTCAAGATTATAGGGGCGACGGCACATTTCGTTACGGCTAGCTTGGATGAGGGG
CCGATCATTGAGCAGAGGGTCGCGAGGGTTGATCATGCTTCGACGCCGAGGGAGTTGGCTGATAGGGGGTCGGAT
ATCGAGTGTCATGTGCTTGCTGCGGCGGTGAGGTGGTATGCGGAAGGGAGGGTGTTTTTGAATGGGACCAAGACG
GTGGTTTTTGATTGA
Transcript >Ophcf2|01616
ATGAAAACACCCAACAAAATGGACAAGAACCACATCCTAACCCTCTCCTGCCCCGACCGTCCCGGCATAATCCAC
GCCGTAACCGCCCTCCTCGCACGCCACCAGCTCAACATCGTCGACATGCGCCAGTTCAGCGACCCGACCTCGCAC
CGCTTCTTCATGCGTCTCCTCATCGGCCCGGCCACCGACACGGCTCACCTCGCGGAGCCCCTTCGCAAACTGGCG
GACGAGTTCGGCATGGATCCCGTTAGGCTTCGGCCCGCGACGCATCGGATAAGGACGCTCGTCATGGTTTCCCAC
ATAGGGCATTGTCTTAATGATCTTGTCTTCCGGGCGGCGTCTTCGGACACACAGCTCCCCATTGAAATCGTGGCC
GTCTGCTCCAACCACACCGAACACGAAGCTCTGGCTCGAAGCAACGGCGTTCCCTTCCACCACCTCCCCATCACC
ATCGACGAAGAAGAAAATGCCACCGATCCAGCCTCCGCCCGCGAAAAGGCAAAGGCCCAACAAGAAGAACGAGTC
CTCTCCCTCGTCAAAACCCTAGACGCCGAACTCGTCGTCCTCGCCCGCTACATGCAAGTCCTCTCACCCAAACTC
TGCGCCGCTCTCTCCGGCCGCATCATCAACATCCACCACTCCTTCCTCCCCTCCTTCAAGGGCGCCAGGCCCTAT
CACCAGGCGTACGAGCGGGGCGTCAAGATTATAGGGGCGACGGCACATTTCGTTACGGCTAGCTTGGATGAGGGG
CCGATCATTGAGCAGAGGGTCGCGAGGGTTGATCATGCTTCGACGCCGAGGGAGTTGGCTGATAGGGGGTCGGAT
ATCGAGTGTCATGTGCTTGCTGCGGCGGTGAGGTGGTATGCGGAAGGGAGGGTGTTTTTGAATGGGACCAAGACG
GTGGTTTTTGATTGA
Gene >Ophcf2|01616
ATGAAAACACCCAACAAAATGGACAAGAACCACATCCTAACCCTCTCCTGCCCCGACCGTCCCGGCATAATCCAC
GCCGTAACCGCCCTCCTCGCACGCCACCAGCTCAACATCGTCGACATGCGCCAGTTCAGCGACCCGACCTCGCAC
CGCTTCTTCATGCGTCTCCTCATCGGCCCGGCCACCGACACGGCTCACCTCGCGGAGCCCCTTCGCAAACTGGCG
GACGAGTTCGGCATGGATCCCGTTAGGCTTCGGCCCGCGACGCATCGGATAAGGACGCTCGTCATGGTTTCCCAC
ATAGGGCATTGTCTTAATGATCTTGTCTTCCGGGCGGCGTCTTCGGACACACAGCTCCCCATTGAAATCGTGGCC
GTCTGCTCCAACCACACCGAACACGAAGCTCTGGCTCGAAGCAACGGCGTTCCCTTCCACCACCTCCCCATCACC
ATCGACGAAGAAGAAAATGCCACCGATCCAGCCTCCGCCCGCGAAAAGGCAAAGGCCCAACAAGAAGAACGAGTC
CTCTCCCTCGTCAAAACCCTAGACGCCGAACTCGTCGTCCTCGCCCGCTACATGCAAGTCCTCTCACCCAAACTC
TGCGCCGCTCTCTCCGGCCGCATCATCAACATCCACCACTCCTTCCTCCCCTCCTTCAAGGGCGCCAGGCCCTAT
CACCAGGCGTACGAGCGGGGCGTCAAGATTATAGGGGCGACGGCACATTTCGTTACGGCTAGCTTGGATGAGGGG
CCGATCATTGAGCAGAGGGTCGCGAGGGTTGATCATGCTTCGACGCCGAGGGAGTTGGCTGATAGGGGGTCGGAT
ATCGAGTGTCATGTGCTTGCTGCGGCGGTGAGGTGGTATGCGGAAGGGAGGGTGTTTTTGAATGGGACCAAGACG
GTGGTTTTTGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail