Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01613
Gene name
Locationscaffold_01:5524530..5526288
Strand-
Gene length (bp)1758
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.1E-20 20 356

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19
2 51 70 19
3 77 99 22
4 103 121 18
5 142 164 22
6 179 196 17
7 240 262 22
8 277 299 22
9 306 325 19
10 330 352 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.26 0.09 2.43
Alive In ants, during behavior modification 15.12 6.11 24.12
Dead In ants, recently dead 7.83 2.56 13.10

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.006330 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01613
MAQPRVQPKWLFPVCLVTSLFFLWGFSYGLLDTLNKHFQDTLGIGKSRSAGLQAAYFGAYPLASLGHAAWTLQRF
GYRVTFVWGLCLFGLGAVLAIPAIKSRSFGGFCACIFVIGSGLGSLETAANPFMGVCGPARQSEIRLNVAQAFSG
VGSVIAPVIGSFAFFRLDAEGALRNVQWIYLAVALLVFVLAAIFFVSDIPEPREEDADLLGEKDREAEEGRDQGH
DDGGRSLTSSQRWRLFHAASAQFCCTGAQIAIAGYFINYVMETRPLTRPATASQLLAGAQGAFALGRFVGALLMR
WIRPRLVLFVFTTLSTALVMPSIWVRGDAAPAIICLAMFFESVCFPTIVALGIRGLGRHSRRGSGAVVDGEVEGE
AVGARREEGVLEMGRRWYRG*
Coding >Ophcf2|01613
ATGGCTCAACCTCGAGTACAACCAAAGTGGCTGTTTCCCGTCTGCCTCGTCACCAGCCTCTTCTTCCTCTGGGGC
TTCTCGTACGGCTTGCTGGACACGCTCAACAAGCATTTCCAGGACACGCTGGGCATCGGCAAATCGCGATCTGCC
GGCCTGCAAGCCGCGTACTTTGGAGCATACCCCCTGGCCTCGCTAGGCCACGCAGCCTGGACCCTGCAGCGGTTC
GGATATCGCGTTACCTTTGTCTGGGGCCTCTGCCTGTTCGGCCTTGGAGCCGTCTTGGCCATTCCAGCCATCAAG
AGTCGCAGTTTTGGCGGCTTTTGCGCCTGTATCTTCGTCATCGGCAGCGGGCTCGGCTCCCTCGAGACTGCGGCG
AACCCTTTCATGGGCGTCTGCGGACCCGCGAGGCAGTCCGAGATACGGCTCAACGTAGCGCAGGCCTTTAGCGGC
GTCGGATCCGTCATCGCCCCCGTGATAGGCTCCTTTGCCTTCTTCCGTCTCGACGCTGAGGGCGCGCTGCGCAAC
GTCCAGTGGATCTACCTCGCTGTCGCTTTGCTCGTCTTCGTCCTGGCCGCCATCTTCTTCGTCTCTGATATTCCG
GAGCCGCGGGAGGAGGATGCCGACTTGTTGGGAGAGAAGGATAGGGAGGCGGAGGAGGGGAGGGATCAGGGTCAT
GATGATGGGGGTCGATCCCTGACTTCGTCTCAGCGGTGGCGTCTTTTTCATGCTGCTTCGGCGCAGTTTTGCTGT
ACGGGTGCACAGATTGCTATTGCTGGATACTTCATCAACTACGTGATGGAGACTCGGCCCCTGACTCGACCCGCG
ACGGCATCACAGCTTCTGGCCGGTGCACAGGGGGCTTTCGCGCTGGGCCGCTTCGTCGGCGCACTGCTGATGCGC
TGGATCCGACCGCGTCTCGTACTGTTCGTCTTCACCACGCTGAGCACCGCGCTGGTGATGCCCTCCATCTGGGTA
AGAGGCGACGCCGCCCCGGCCATCATCTGTCTAGCCATGTTCTTCGAGTCGGTCTGCTTCCCGACCATCGTTGCG
CTGGGGATCCGCGGCCTGGGGCGTCATAGCCGAAGGGGGTCTGGGGCTGTTGTTGATGGGGAGGTCGAGGGAGAG
GCCGTTGGGGCGAGGAGGGAGGAGGGCGTGTTGGAGATGGGGAGGCGTTGGTATCGGGGGTGA
Transcript >Ophcf2|01613
ATGGCTCAACCTCGAGTACAACCAAAGTGGCTGTTTCCCGTCTGCCTCGTCACCAGCCTCTTCTTCCTCTGGGGC
TTCTCGTACGGCTTGCTGGACACGCTCAACAAGCATTTCCAGGACACGCTGGGCATCGGCAAATCGCGATCTGCC
GGCCTGCAAGCCGCGTACTTTGGAGCATACCCCCTGGCCTCGCTAGGCCACGCAGCCTGGACCCTGCAGCGGTTC
GGATATCGCGTTACCTTTGTCTGGGGCCTCTGCCTGTTCGGCCTTGGAGCCGTCTTGGCCATTCCAGCCATCAAG
AGTCGCAGTTTTGGCGGCTTTTGCGCCTGTATCTTCGTCATCGGCAGCGGGCTCGGCTCCCTCGAGACTGCGGCG
AACCCTTTCATGGGCGTCTGCGGACCCGCGAGGCAGTCCGAGATACGGCTCAACGTAGCGCAGGCCTTTAGCGGC
GTCGGATCCGTCATCGCCCCCGTGATAGGCTCCTTTGCCTTCTTCCGTCTCGACGCTGAGGGCGCGCTGCGCAAC
GTCCAGTGGATCTACCTCGCTGTCGCTTTGCTCGTCTTCGTCCTGGCCGCCATCTTCTTCGTCTCTGATATTCCG
GAGCCGCGGGAGGAGGATGCCGACTTGTTGGGAGAGAAGGATAGGGAGGCGGAGGAGGGGAGGGATCAGGGTCAT
GATGATGGGGGTCGATCCCTGACTTCGTCTCAGCGGTGGCGTCTTTTTCATGCTGCTTCGGCGCAGTTTTGCTGT
ACGGGTGCACAGATTGCTATTGCTGGATACTTCATCAACTACGTGATGGAGACTCGGCCCCTGACTCGACCCGCG
ACGGCATCACAGCTTCTGGCCGGTGCACAGGGGGCTTTCGCGCTGGGCCGCTTCGTCGGCGCACTGCTGATGCGC
TGGATCCGACCGCGTCTCGTACTGTTCGTCTTCACCACGCTGAGCACCGCGCTGGTGATGCCCTCCATCTGGGTA
AGAGGCGACGCCGCCCCGGCCATCATCTGTCTAGCCATGTTCTTCGAGTCGGTCTGCTTCCCGACCATCGTTGCG
CTGGGGATCCGCGGCCTGGGGCGTCATAGCCGAAGGGGGTCTGGGGCTGTTGTTGATGGGGAGGTCGAGGGAGAG
GCCGTTGGGGCGAGGAGGGAGGAGGGCGTGTTGGAGATGGGGAGGCGTTGGTATCGGGGGTGA
Gene >Ophcf2|01613
ATGGCTCAACCTCGAGTACAACCAAAGTGGCTGTTTCCCGTCTGCCTCGTCACCAGCCTCTTCTTCCTCTGGGGC
TTCTCGTACGGCTTGCTGGACACGCTCAACAAGCATTTCCAGGACACGCTGGGCATCGGCAAATCGCGATCTGCC
GGCCTGCAAGCCGCGTACTTTGGGTGCGTCCTGCTCGATATATATATATACATACATAACTCCGTTGCATGCCAT
GGAATGTCCGGATCCTGACACAGGCCACGTCAAGAGCATACCCCCTGGCCTCGCTAGGCCACGCAGCCTGGACCC
TGCAGCGGTTCGGATATCGCGTTACCTTTGTCTGGGGCCTCTGCCTGTTCGGTATGTTATACACACACACACACA
CATGCACACATGCACACATGCACACATACACACATACACACATACACACAAACACACATACACACATACATGCTT
TCGCCTGTTGTTCTCTTTGCCGTTGTCTTCTTTCTTGTTGTATGTATGTACATACATACATACATACATACATAC
ATACATGGCCTTGGCTCATGCGATGACTGACCCGCTCCAAGGCCTTGGAGCCGTCTTGGCCATTCCAGCCATCAA
GAGTCGCAGTTTTGGCGGCTTTTGCGCCTGTATCTTCGTCATCGGCAGCGGGCTCGGCTCCCTCGAGACTGCGGC
GAACCCTTTCATGGGCGGTATGTGCGTTCCCCTGACTATCCTCACGGGCAGTGACGCTGAAGAACTGGGTCAGTC
TGCGGACCCGCGAGGCAGTCCGAGATACGGCTCAACGTAGCGCAGGCCTTTAGCGGCGTCGGATCCGTCATCGCC
CCCGTGATAGGCTCCTTTGCCTTCTTCCGTCTCGACGCTGAGGGCGCGCTGCGCAACGTCCAGTGGATCTACCTC
GCTGTCGCTTTGCTCGTCTTCGTCCTGGCCGCCATCTTCTTCGTCTCTGATATTCCGGAGCCGCGGGAGGAGGAT
GCCGACTTGTTGGGAGAGAAGGATAGGGAGGCGGAGGAGGGGAGGGATCAGGGTCATGATGATGGGGGTCGATCC
CTGACTTCGTCTCAGCGGTGGCGTCTTTTTCATGCTGCTTCGGCGCAGTTTTGCTGTACGGGTGCACAGATTGCT
ATTGCTGGGTAAGAAGATGACATGCCGCTACATCGTCCATTGACTGACGGACGAGCATCACAGATACTTCATCAA
CTACGTGATGGAGACTCGGCCCCTGACTCGACCCGCGACGGCATCACAGCTTCTGGCCGGTGCACAGGGGGCTTT
CGCGCTGGGCCGCTTCGTCGGCGCACTGCTGATGCGCTGGATCCGACCGCGTCTCGTACTGTTCGTCTTCACCAC
GCTGAGCACCGCGCTGGTGATGCCCTCCATCTGGGTAAGAGGCGACGCCGCCCCGGCCATCATCTGTCTAGCCAT
GTTCTTCGAGTCGGTCTGCTTCCCGACCATCGTTGCGCTGGGGATCCGCGGCCTGGGGCGTCATAGCCGAAGGGG
GTCTGGGTATGTGGTTGGGGGGATCGTGGGTGGTGCGTGCGTGCCTCCGCTTATGGGGGCCGTTGCGGATGGTAG
GGGACGGCGGTGGGGATGGCGGTGCCTTGTGCCTTTCTGGTGGTTGGGTGGACGTATGCCGTTGCTGTGAATGTT
GTGCCTGGGTATAGGGCTGTTGTTGATGGGGAGGTCGAGGGAGAGGCCGTTGGGGCGAGGAGGGAGGAGGGCGTG
TTGGAGATGGGGAGGCGTTGGTATCGGGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail