Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01611
Gene name
Locationscaffold_01:5520372..5520960
Strand+
Gene length (bp)588
Transcript length (bp)588
Coding sequence length (bp)588
Protein length (aa) 196

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.8E-11 17 104
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.7E-08 70 137
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.1E-07 112 193
PF13637 Ank_4 Ankyrin repeats (many copies) 5.2E-06 82 127
PF13637 Ank_4 Ankyrin repeats (many copies) 1.5E-05 122 159
PF00023 Ank Ankyrin repeat 9.9E-03 73 105
PF00023 Ank Ankyrin repeat 2.1E-04 108 137

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.7003 0.6101 0.0693 0.1497 0.3701 0.2429 0.0534 0.339 0.1208 0.075

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup7290
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01611 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1581
Ophiocordyceps kimflemingae Ophio5|3102

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01611
MSDALQEILTASVTDRNESMVRHLLENPLVDPGLPDRRGETALFRAVLNNDPVIMKMLLDTGRTLPNHLDGSGWT
PLTYTSMMGRAELTEMLLDTPGIDPNVRDKTSWTPLLYASAGGFGRIVELLINSGADPNAADRQHRSPLWWAVVN
HHPNVVKLLMATRKVDPRQGDRYHQSPLDVAKLESDVDMVGLLTP*
Coding >Ophcf2|01611
ATGTCCGACGCCCTGCAAGAGATTCTCACCGCCTCGGTAACAGACAGAAACGAATCAATGGTTCGACACCTCCTC
GAAAACCCGCTCGTCGACCCCGGCCTCCCAGACAGGAGAGGAGAAACGGCCCTCTTCCGAGCAGTTCTGAACAAC
GACCCCGTCATCATGAAGATGCTCCTCGACACAGGCCGCACCCTCCCCAACCATCTCGATGGCAGCGGCTGGACA
CCTCTCACCTACACTAGCATGATGGGCAGGGCCGAACTGACAGAGATGCTCCTCGACACCCCCGGCATCGACCCC
AACGTCAGGGACAAAACCAGCTGGACGCCCCTCTTATACGCCTCAGCCGGCGGCTTCGGCCGTATCGTCGAGCTG
CTAATCAATTCCGGCGCCGATCCCAACGCCGCGGACAGGCAGCACAGGTCGCCGCTGTGGTGGGCGGTGGTGAAT
CACCATCCCAACGTTGTGAAGCTGCTCATGGCTACCCGCAAGGTTGATCCCAGGCAGGGGGACAGGTATCATCAA
TCGCCGTTGGATGTTGCGAAGCTTGAGTCTGACGTGGACATGGTCGGTCTCCTGACGCCTTGA
Transcript >Ophcf2|01611
ATGTCCGACGCCCTGCAAGAGATTCTCACCGCCTCGGTAACAGACAGAAACGAATCAATGGTTCGACACCTCCTC
GAAAACCCGCTCGTCGACCCCGGCCTCCCAGACAGGAGAGGAGAAACGGCCCTCTTCCGAGCAGTTCTGAACAAC
GACCCCGTCATCATGAAGATGCTCCTCGACACAGGCCGCACCCTCCCCAACCATCTCGATGGCAGCGGCTGGACA
CCTCTCACCTACACTAGCATGATGGGCAGGGCCGAACTGACAGAGATGCTCCTCGACACCCCCGGCATCGACCCC
AACGTCAGGGACAAAACCAGCTGGACGCCCCTCTTATACGCCTCAGCCGGCGGCTTCGGCCGTATCGTCGAGCTG
CTAATCAATTCCGGCGCCGATCCCAACGCCGCGGACAGGCAGCACAGGTCGCCGCTGTGGTGGGCGGTGGTGAAT
CACCATCCCAACGTTGTGAAGCTGCTCATGGCTACCCGCAAGGTTGATCCCAGGCAGGGGGACAGGTATCATCAA
TCGCCGTTGGATGTTGCGAAGCTTGAGTCTGACGTGGACATGGTCGGTCTCCTGACGCCTTGA
Gene >Ophcf2|01611
ATGTCCGACGCCCTGCAAGAGATTCTCACCGCCTCGGTAACAGACAGAAACGAATCAATGGTTCGACACCTCCTC
GAAAACCCGCTCGTCGACCCCGGCCTCCCAGACAGGAGAGGAGAAACGGCCCTCTTCCGAGCAGTTCTGAACAAC
GACCCCGTCATCATGAAGATGCTCCTCGACACAGGCCGCACCCTCCCCAACCATCTCGATGGCAGCGGCTGGACA
CCTCTCACCTACACTAGCATGATGGGCAGGGCCGAACTGACAGAGATGCTCCTCGACACCCCCGGCATCGACCCC
AACGTCAGGGACAAAACCAGCTGGACGCCCCTCTTATACGCCTCAGCCGGCGGCTTCGGCCGTATCGTCGAGCTG
CTAATCAATTCCGGCGCCGATCCCAACGCCGCGGACAGGCAGCACAGGTCGCCGCTGTGGTGGGCGGTGGTGAAT
CACCATCCCAACGTTGTGAAGCTGCTCATGGCTACCCGCAAGGTTGATCCCAGGCAGGGGGACAGGTATCATCAA
TCGCCGTTGGATGTTGCGAAGCTTGAGTCTGACGTGGACATGGTCGGTCTCCTGACGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail