Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01610
Gene name
Locationscaffold_01:5516383..5518996
Strand+
Gene length (bp)2613
Transcript length (bp)2613
Coding sequence length (bp)2613
Protein length (aa) 871

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.4E-07 741 804
PF13637 Ank_4 Ankyrin repeats (many copies) 8.4E-06 743 796
PF00023 Ank Ankyrin repeat 4.6E-05 775 806

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.2731 0.3087 0.4669 0.122 0.5041 0.3262 0.132 0.1308 0.191 0.1472

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup7289
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01610 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1580
Ophiocordyceps kimflemingae Ophio5|3101

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01610
MGFDATTPPPLPHRNTPNPSPQGTIRASGAEEKVVKYVYLVSSQDIVDMKQAGGIFPSGYAAPQSSPNSMMMEYL
SSQELKAYVLTYRDFSDAARAAAADRNAGSNKMRIWKVKTTPNMFPQSSFASIPDGEGERFLALGGVHRGQIMGY
YKMGNNPERQRTATIRQGATPKEAGYKYVASRGYKAMTYSKQRHVFASELSDEVRDDIQTLLALPDCRVPGSGRR
MRRWTSCVWREGISEAKDLKTGQVSEQAVEEMKVKQALDSSRPAEQRDERIPSQTKDFNLEVEQVSKQGNQNLRA
KQPLYASLSSRQGSGKLTSRPNPESNPFNLKDPPLPSENTHISIPSSPEENVEQAVARIDGNELAIMADGIASQL
FKDVIRRLRINLPRYFNGAVTTTAALRVELAKVTSIRSWSIGYGSGALLAAVTTSYVWDLVHAWRDEQVSHLDKM
AVTMSPFPLAGCSFKAMSDTDAGVLSPAGTSLCFIGDSLLFTPFAPMSVFFRALGSVVDHLEQESVGYIIRRHDA
GWKKHYDELQHEIQSEAFRFNVSERYATEQAVIVYGATEQMGMLLAGKRIAHRDEIKKVEAKTLLEIRSILQAMC
GRMRYKKLWYRAWLPVTLGHLMRAQAANYTASFLERQTNRTLMELASERDMAVITDFRFPQPASRALEREAAVRD
KLKMLTNRLGILKRVDVEKQVESIDMLAEDVLSKIDFSLPDMCNCPVQVDEIELLLSIRNSTTQLEAALLCAASK
GYNDVVKHILVKALSTVDINAVDEDGNTALMLAVKGSHASIIDMLLSADADKDAVNKKGETAALISAKADKYHHG
PPPRRSRRIDTVMPDNHYTTNQTAFKPKRSRRIDTSMADNAYTLL*
Coding >Ophcf2|01610
ATGGGATTTGACGCAACAACGCCGCCACCGCTGCCACACAGAAACACCCCCAATCCAAGCCCGCAGGGAACAATA
CGTGCATCAGGAGCAGAGGAAAAGGTAGTCAAATACGTCTACCTCGTCAGCTCGCAGGACATTGTCGACATGAAA
CAAGCGGGCGGCATCTTCCCCTCGGGCTATGCGGCGCCTCAATCTTCGCCCAACTCTATGATGATGGAATACCTA
TCCAGCCAGGAACTCAAAGCATACGTCCTGACCTACCGAGACTTCTCAGACGCAGCCCGAGCAGCGGCAGCGGAT
CGCAATGCAGGAAGCAACAAGATGCGCATCTGGAAGGTCAAGACGACGCCCAACATGTTTCCTCAGAGTAGCTTC
GCATCCATCCCGGACGGAGAGGGCGAGCGCTTCCTCGCTCTCGGCGGTGTTCACAGGGGTCAGATAATGGGATAC
TACAAAATGGGCAACAATCCAGAACGGCAGCGGACAGCCACGATACGACAGGGAGCCACGCCCAAGGAGGCAGGC
TACAAGTACGTCGCCAGCCGCGGATATAAGGCCATGACGTACAGCAAGCAGCGACACGTCTTCGCCAGCGAGCTA
AGCGACGAAGTCAGGGATGATATCCAGACGTTGCTCGCATTGCCGGATTGCAGGGTGCCCGGTTCGGGGAGGAGG
ATGAGACGCTGGACTTCGTGCGTCTGGCGAGAAGGAATCTCGGAAGCTAAAGACTTGAAGACTGGGCAAGTCTCC
GAGCAAGCTGTTGAAGAGATGAAAGTGAAGCAAGCCCTCGACTCATCCCGACCAGCTGAGCAAAGAGACGAAAGA
ATCCCGTCCCAAACCAAAGACTTCAACCTCGAAGTCGAACAAGTCTCCAAGCAAGGCAACCAAAACCTCAGAGCG
AAACAACCCCTCTACGCATCCCTCTCATCCCGACAAGGATCCGGAAAGCTAACATCAAGGCCCAACCCCGAGTCA
AACCCCTTCAACTTGAAGGACCCTCCCCTCCCCTCAGAAAACACCCACATCTCCATTCCCTCGAGCCCGGAAGAA
AACGTCGAGCAAGCCGTCGCCCGTATAGACGGCAATGAACTGGCAATCATGGCCGACGGCATCGCCAGCCAGCTC
TTCAAAGACGTAATTCGGCGTCTCCGAATCAACCTCCCGCGCTACTTCAACGGCGCCGTCACGACAACGGCTGCC
CTCCGTGTTGAGCTCGCAAAAGTCACTTCCATCAGATCCTGGTCCATCGGGTACGGAAGCGGTGCTCTTCTCGCC
GCTGTCACGACGTCGTATGTCTGGGATCTTGTCCACGCCTGGCGAGACGAGCAGGTATCACACCTGGATAAGATG
GCCGTGACCATGTCGCCTTTTCCACTGGCGGGATGCTCCTTCAAAGCCATGTCCGATACGGACGCCGGGGTGCTG
AGCCCGGCCGGGACTTCGCTATGTTTCATCGGCGATAGTCTCTTGTTCACGCCATTCGCGCCCATGTCTGTCTTC
TTCCGGGCACTGGGCAGCGTCGTCGATCACTTAGAGCAAGAGAGCGTCGGCTACATCATCCGCAGACACGACGCG
GGCTGGAAGAAGCACTACGACGAGCTCCAACACGAAATCCAGTCCGAGGCCTTCCGCTTCAACGTCAGCGAGCGG
TACGCAACCGAGCAAGCCGTCATCGTATACGGAGCAACGGAGCAGATGGGCATGCTCCTAGCCGGCAAAAGGATA
GCTCACCGCGACGAGATCAAAAAGGTCGAAGCCAAGACGCTTCTCGAGATTCGATCGATCCTACAAGCTATGTGC
GGCCGGATGCGCTACAAGAAGCTTTGGTATCGAGCCTGGCTTCCCGTCACATTGGGTCACCTCATGCGCGCCCAG
GCAGCAAACTACACAGCCAGCTTCCTCGAACGGCAGACGAACCGGACGCTGATGGAGCTGGCATCTGAGCGGGAC
ATGGCCGTCATCACTGACTTTCGCTTCCCGCAGCCGGCGTCGAGGGCTCTTGAGCGCGAGGCGGCTGTTCGTGAT
AAGCTGAAGATGCTGACCAACCGACTGGGAATCTTGAAGCGTGTCGACGTCGAGAAGCAGGTGGAAAGTATAGAT
ATGCTTGCTGAAGACGTCCTGAGCAAGATTGACTTTTCCCTGCCCGACATGTGCAACTGTCCGGTTCAAGTAGAC
GAGATCGAACTGCTCCTTTCCATTCGCAACTCGACCACTCAACTGGAGGCAGCTCTTCTCTGCGCAGCTTCAAAG
GGTTACAACGACGTCGTCAAGCACATCCTCGTAAAGGCCCTCTCCACCGTCGATATCAACGCCGTGGATGAGGAC
GGTAACACGGCGCTGATGCTGGCCGTCAAGGGCTCCCACGCCTCCATCATCGACATGCTGCTATCCGCCGACGCC
GACAAGGACGCTGTCAACAAAAAGGGCGAGACGGCGGCATTGATCAGCGCCAAGGCGGACAAGTATCATCACGGT
CCGCCCCCCAGAAGGAGCCGGAGGATCGACACCGTCATGCCCGATAACCACTATACCACAAATCAGACGGCCTTC
AAGCCGAAACGCTCTCGAAGAATCGATACGTCCATGGCGGATAACGCTTATACCCTGCTGTAG
Transcript >Ophcf2|01610
ATGGGATTTGACGCAACAACGCCGCCACCGCTGCCACACAGAAACACCCCCAATCCAAGCCCGCAGGGAACAATA
CGTGCATCAGGAGCAGAGGAAAAGGTAGTCAAATACGTCTACCTCGTCAGCTCGCAGGACATTGTCGACATGAAA
CAAGCGGGCGGCATCTTCCCCTCGGGCTATGCGGCGCCTCAATCTTCGCCCAACTCTATGATGATGGAATACCTA
TCCAGCCAGGAACTCAAAGCATACGTCCTGACCTACCGAGACTTCTCAGACGCAGCCCGAGCAGCGGCAGCGGAT
CGCAATGCAGGAAGCAACAAGATGCGCATCTGGAAGGTCAAGACGACGCCCAACATGTTTCCTCAGAGTAGCTTC
GCATCCATCCCGGACGGAGAGGGCGAGCGCTTCCTCGCTCTCGGCGGTGTTCACAGGGGTCAGATAATGGGATAC
TACAAAATGGGCAACAATCCAGAACGGCAGCGGACAGCCACGATACGACAGGGAGCCACGCCCAAGGAGGCAGGC
TACAAGTACGTCGCCAGCCGCGGATATAAGGCCATGACGTACAGCAAGCAGCGACACGTCTTCGCCAGCGAGCTA
AGCGACGAAGTCAGGGATGATATCCAGACGTTGCTCGCATTGCCGGATTGCAGGGTGCCCGGTTCGGGGAGGAGG
ATGAGACGCTGGACTTCGTGCGTCTGGCGAGAAGGAATCTCGGAAGCTAAAGACTTGAAGACTGGGCAAGTCTCC
GAGCAAGCTGTTGAAGAGATGAAAGTGAAGCAAGCCCTCGACTCATCCCGACCAGCTGAGCAAAGAGACGAAAGA
ATCCCGTCCCAAACCAAAGACTTCAACCTCGAAGTCGAACAAGTCTCCAAGCAAGGCAACCAAAACCTCAGAGCG
AAACAACCCCTCTACGCATCCCTCTCATCCCGACAAGGATCCGGAAAGCTAACATCAAGGCCCAACCCCGAGTCA
AACCCCTTCAACTTGAAGGACCCTCCCCTCCCCTCAGAAAACACCCACATCTCCATTCCCTCGAGCCCGGAAGAA
AACGTCGAGCAAGCCGTCGCCCGTATAGACGGCAATGAACTGGCAATCATGGCCGACGGCATCGCCAGCCAGCTC
TTCAAAGACGTAATTCGGCGTCTCCGAATCAACCTCCCGCGCTACTTCAACGGCGCCGTCACGACAACGGCTGCC
CTCCGTGTTGAGCTCGCAAAAGTCACTTCCATCAGATCCTGGTCCATCGGGTACGGAAGCGGTGCTCTTCTCGCC
GCTGTCACGACGTCGTATGTCTGGGATCTTGTCCACGCCTGGCGAGACGAGCAGGTATCACACCTGGATAAGATG
GCCGTGACCATGTCGCCTTTTCCACTGGCGGGATGCTCCTTCAAAGCCATGTCCGATACGGACGCCGGGGTGCTG
AGCCCGGCCGGGACTTCGCTATGTTTCATCGGCGATAGTCTCTTGTTCACGCCATTCGCGCCCATGTCTGTCTTC
TTCCGGGCACTGGGCAGCGTCGTCGATCACTTAGAGCAAGAGAGCGTCGGCTACATCATCCGCAGACACGACGCG
GGCTGGAAGAAGCACTACGACGAGCTCCAACACGAAATCCAGTCCGAGGCCTTCCGCTTCAACGTCAGCGAGCGG
TACGCAACCGAGCAAGCCGTCATCGTATACGGAGCAACGGAGCAGATGGGCATGCTCCTAGCCGGCAAAAGGATA
GCTCACCGCGACGAGATCAAAAAGGTCGAAGCCAAGACGCTTCTCGAGATTCGATCGATCCTACAAGCTATGTGC
GGCCGGATGCGCTACAAGAAGCTTTGGTATCGAGCCTGGCTTCCCGTCACATTGGGTCACCTCATGCGCGCCCAG
GCAGCAAACTACACAGCCAGCTTCCTCGAACGGCAGACGAACCGGACGCTGATGGAGCTGGCATCTGAGCGGGAC
ATGGCCGTCATCACTGACTTTCGCTTCCCGCAGCCGGCGTCGAGGGCTCTTGAGCGCGAGGCGGCTGTTCGTGAT
AAGCTGAAGATGCTGACCAACCGACTGGGAATCTTGAAGCGTGTCGACGTCGAGAAGCAGGTGGAAAGTATAGAT
ATGCTTGCTGAAGACGTCCTGAGCAAGATTGACTTTTCCCTGCCCGACATGTGCAACTGTCCGGTTCAAGTAGAC
GAGATCGAACTGCTCCTTTCCATTCGCAACTCGACCACTCAACTGGAGGCAGCTCTTCTCTGCGCAGCTTCAAAG
GGTTACAACGACGTCGTCAAGCACATCCTCGTAAAGGCCCTCTCCACCGTCGATATCAACGCCGTGGATGAGGAC
GGTAACACGGCGCTGATGCTGGCCGTCAAGGGCTCCCACGCCTCCATCATCGACATGCTGCTATCCGCCGACGCC
GACAAGGACGCTGTCAACAAAAAGGGCGAGACGGCGGCATTGATCAGCGCCAAGGCGGACAAGTATCATCACGGT
CCGCCCCCCAGAAGGAGCCGGAGGATCGACACCGTCATGCCCGATAACCACTATACCACAAATCAGACGGCCTTC
AAGCCGAAACGCTCTCGAAGAATCGATACGTCCATGGCGGATAACGCTTATACCCTGCTGTAG
Gene >Ophcf2|01610
ATGGGATTTGACGCAACAACGCCGCCACCGCTGCCACACAGAAACACCCCCAATCCAAGCCCGCAGGGAACAATA
CGTGCATCAGGAGCAGAGGAAAAGGTAGTCAAATACGTCTACCTCGTCAGCTCGCAGGACATTGTCGACATGAAA
CAAGCGGGCGGCATCTTCCCCTCGGGCTATGCGGCGCCTCAATCTTCGCCCAACTCTATGATGATGGAATACCTA
TCCAGCCAGGAACTCAAAGCATACGTCCTGACCTACCGAGACTTCTCAGACGCAGCCCGAGCAGCGGCAGCGGAT
CGCAATGCAGGAAGCAACAAGATGCGCATCTGGAAGGTCAAGACGACGCCCAACATGTTTCCTCAGAGTAGCTTC
GCATCCATCCCGGACGGAGAGGGCGAGCGCTTCCTCGCTCTCGGCGGTGTTCACAGGGGTCAGATAATGGGATAC
TACAAAATGGGCAACAATCCAGAACGGCAGCGGACAGCCACGATACGACAGGGAGCCACGCCCAAGGAGGCAGGC
TACAAGTACGTCGCCAGCCGCGGATATAAGGCCATGACGTACAGCAAGCAGCGACACGTCTTCGCCAGCGAGCTA
AGCGACGAAGTCAGGGATGATATCCAGACGTTGCTCGCATTGCCGGATTGCAGGGTGCCCGGTTCGGGGAGGAGG
ATGAGACGCTGGACTTCGTGCGTCTGGCGAGAAGGAATCTCGGAAGCTAAAGACTTGAAGACTGGGCAAGTCTCC
GAGCAAGCTGTTGAAGAGATGAAAGTGAAGCAAGCCCTCGACTCATCCCGACCAGCTGAGCAAAGAGACGAAAGA
ATCCCGTCCCAAACCAAAGACTTCAACCTCGAAGTCGAACAAGTCTCCAAGCAAGGCAACCAAAACCTCAGAGCG
AAACAACCCCTCTACGCATCCCTCTCATCCCGACAAGGATCCGGAAAGCTAACATCAAGGCCCAACCCCGAGTCA
AACCCCTTCAACTTGAAGGACCCTCCCCTCCCCTCAGAAAACACCCACATCTCCATTCCCTCGAGCCCGGAAGAA
AACGTCGAGCAAGCCGTCGCCCGTATAGACGGCAATGAACTGGCAATCATGGCCGACGGCATCGCCAGCCAGCTC
TTCAAAGACGTAATTCGGCGTCTCCGAATCAACCTCCCGCGCTACTTCAACGGCGCCGTCACGACAACGGCTGCC
CTCCGTGTTGAGCTCGCAAAAGTCACTTCCATCAGATCCTGGTCCATCGGGTACGGAAGCGGTGCTCTTCTCGCC
GCTGTCACGACGTCGTATGTCTGGGATCTTGTCCACGCCTGGCGAGACGAGCAGGTATCACACCTGGATAAGATG
GCCGTGACCATGTCGCCTTTTCCACTGGCGGGATGCTCCTTCAAAGCCATGTCCGATACGGACGCCGGGGTGCTG
AGCCCGGCCGGGACTTCGCTATGTTTCATCGGCGATAGTCTCTTGTTCACGCCATTCGCGCCCATGTCTGTCTTC
TTCCGGGCACTGGGCAGCGTCGTCGATCACTTAGAGCAAGAGAGCGTCGGCTACATCATCCGCAGACACGACGCG
GGCTGGAAGAAGCACTACGACGAGCTCCAACACGAAATCCAGTCCGAGGCCTTCCGCTTCAACGTCAGCGAGCGG
TACGCAACCGAGCAAGCCGTCATCGTATACGGAGCAACGGAGCAGATGGGCATGCTCCTAGCCGGCAAAAGGATA
GCTCACCGCGACGAGATCAAAAAGGTCGAAGCCAAGACGCTTCTCGAGATTCGATCGATCCTACAAGCTATGTGC
GGCCGGATGCGCTACAAGAAGCTTTGGTATCGAGCCTGGCTTCCCGTCACATTGGGTCACCTCATGCGCGCCCAG
GCAGCAAACTACACAGCCAGCTTCCTCGAACGGCAGACGAACCGGACGCTGATGGAGCTGGCATCTGAGCGGGAC
ATGGCCGTCATCACTGACTTTCGCTTCCCGCAGCCGGCGTCGAGGGCTCTTGAGCGCGAGGCGGCTGTTCGTGAT
AAGCTGAAGATGCTGACCAACCGACTGGGAATCTTGAAGCGTGTCGACGTCGAGAAGCAGGTGGAAAGTATAGAT
ATGCTTGCTGAAGACGTCCTGAGCAAGATTGACTTTTCCCTGCCCGACATGTGCAACTGTCCGGTTCAAGTAGAC
GAGATCGAACTGCTCCTTTCCATTCGCAACTCGACCACTCAACTGGAGGCAGCTCTTCTCTGCGCAGCTTCAAAG
GGTTACAACGACGTCGTCAAGCACATCCTCGTAAAGGCCCTCTCCACCGTCGATATCAACGCCGTGGATGAGGAC
GGTAACACGGCGCTGATGCTGGCCGTCAAGGGCTCCCACGCCTCCATCATCGACATGCTGCTATCCGCCGACGCC
GACAAGGACGCTGTCAACAAAAAGGGCGAGACGGCGGCATTGATCAGCGCCAAGGCGGACAAGTATCATCACGGT
CCGCCCCCCAGAAGGAGCCGGAGGATCGACACCGTCATGCCCGATAACCACTATACCACAAATCAGACGGCCTTC
AAGCCGAAACGCTCTCGAAGAATCGATACGTCCATGGCGGATAACGCTTATACCCTGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail