Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01608
Gene name
Locationscaffold_01:5476793..5477885
Strand+
Gene length (bp)1092
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 6.0E-08 161 204

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 40.16 20.60 59.72
Alive In ants, during behavior modification 48.92 25.62 72.22
Dead In ants, recently dead 60.39 33.48 87.30

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.383472 no
Alive Dead 0.241555 no
Dead Fungus 0.047545 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01608
MVSLFRICLLIALAFSIYHVFPPLILFGEWLSQNHPFSNQRAVEQDFTPTPKELACLHGLPLPGTLATTTEQTPI
PNVVNFVFFQQLPSSKPEGDFGFLAYLAVRSAIVSLKPDHVYIHYGFASSPSRFGRVSQAPLGESIIMRNPWIRR
LRPHVELKPYTKPFDRSLKHREHLADRVRLEILLQHGGIYMDLDAFALRPFAEALSPSPPHDAILGYEGGNRAGL
CNAVIAARPNSSFIHRWLHTYDKADLNAEWNYHSVILPRQLAHNHPDEVCELPPDAFFWPTWTWGDVRWMHEPLS
PPDAEFWKGRIQELGGSLFPNQLVYHAWSQMSRNRYLKRLRPDVIRAENTRFNLLMRRFLEDD*
Coding >Ophcf2|01608
ATGGTCTCCCTCTTCCGCATCTGCCTCCTCATCGCCCTCGCCTTCTCCATCTACCACGTCTTCCCACCACTCATC
CTCTTCGGCGAATGGCTATCACAGAACCATCCCTTCTCCAACCAAAGAGCCGTCGAGCAAGACTTCACCCCGACA
CCCAAGGAACTCGCCTGCCTGCACGGCCTGCCTCTTCCCGGAACCCTCGCGACGACCACAGAACAGACGCCGATA
CCAAACGTCGTCAACTTCGTCTTCTTCCAGCAGCTCCCTTCCAGCAAGCCAGAGGGAGACTTTGGCTTCCTCGCC
TACCTCGCCGTCCGGAGCGCCATAGTCTCCCTGAAGCCCGACCATGTCTACATCCACTACGGCTTTGCCTCCTCG
CCTTCGCGCTTCGGTCGTGTCTCTCAGGCGCCGCTCGGCGAGAGCATCATCATGCGCAATCCCTGGATCCGACGA
CTGAGGCCGCATGTCGAGCTGAAGCCATACACGAAGCCCTTTGATCGCTCCCTCAAGCATAGAGAGCACCTCGCC
GACCGCGTTCGACTCGAGATTTTACTCCAACACGGCGGCATCTACATGGATCTGGACGCCTTTGCCCTCCGGCCT
TTTGCAGAAGCGCTCTCGCCCTCGCCGCCTCACGATGCTATCCTCGGTTATGAAGGCGGTAACCGCGCCGGTCTA
TGCAACGCCGTCATCGCCGCTCGACCAAACAGCTCCTTTATCCATCGCTGGCTTCACACGTATGACAAGGCCGAC
CTCAACGCCGAGTGGAACTACCACAGCGTTATCCTCCCGCGCCAGCTCGCCCACAATCACCCAGACGAAGTCTGC
GAGCTGCCTCCCGATGCCTTCTTCTGGCCGACCTGGACATGGGGCGACGTTCGGTGGATGCATGAGCCCCTGAGC
CCGCCGGATGCCGAGTTCTGGAAGGGCCGAATACAGGAGTTGGGCGGTAGCTTGTTCCCGAATCAGCTCGTCTAT
CATGCCTGGAGCCAGATGAGCAGGAACCGCTATCTGAAACGCCTGAGGCCGGATGTCATCCGTGCGGAAAACACG
AGGTTCAATCTGCTTATGAGACGTTTTCTGGAGGATGACTGA
Transcript >Ophcf2|01608
ATGGTCTCCCTCTTCCGCATCTGCCTCCTCATCGCCCTCGCCTTCTCCATCTACCACGTCTTCCCACCACTCATC
CTCTTCGGCGAATGGCTATCACAGAACCATCCCTTCTCCAACCAAAGAGCCGTCGAGCAAGACTTCACCCCGACA
CCCAAGGAACTCGCCTGCCTGCACGGCCTGCCTCTTCCCGGAACCCTCGCGACGACCACAGAACAGACGCCGATA
CCAAACGTCGTCAACTTCGTCTTCTTCCAGCAGCTCCCTTCCAGCAAGCCAGAGGGAGACTTTGGCTTCCTCGCC
TACCTCGCCGTCCGGAGCGCCATAGTCTCCCTGAAGCCCGACCATGTCTACATCCACTACGGCTTTGCCTCCTCG
CCTTCGCGCTTCGGTCGTGTCTCTCAGGCGCCGCTCGGCGAGAGCATCATCATGCGCAATCCCTGGATCCGACGA
CTGAGGCCGCATGTCGAGCTGAAGCCATACACGAAGCCCTTTGATCGCTCCCTCAAGCATAGAGAGCACCTCGCC
GACCGCGTTCGACTCGAGATTTTACTCCAACACGGCGGCATCTACATGGATCTGGACGCCTTTGCCCTCCGGCCT
TTTGCAGAAGCGCTCTCGCCCTCGCCGCCTCACGATGCTATCCTCGGTTATGAAGGCGGTAACCGCGCCGGTCTA
TGCAACGCCGTCATCGCCGCTCGACCAAACAGCTCCTTTATCCATCGCTGGCTTCACACGTATGACAAGGCCGAC
CTCAACGCCGAGTGGAACTACCACAGCGTTATCCTCCCGCGCCAGCTCGCCCACAATCACCCAGACGAAGTCTGC
GAGCTGCCTCCCGATGCCTTCTTCTGGCCGACCTGGACATGGGGCGACGTTCGGTGGATGCATGAGCCCCTGAGC
CCGCCGGATGCCGAGTTCTGGAAGGGCCGAATACAGGAGTTGGGCGGTAGCTTGTTCCCGAATCAGCTCGTCTAT
CATGCCTGGAGCCAGATGAGCAGGAACCGCTATCTGAAACGCCTGAGGCCGGATGTCATCCGTGCGGAAAACACG
AGGTTCAATCTGCTTATGAGACGTTTTCTGGAGGATGACTGA
Gene >Ophcf2|01608
ATGGTCTCCCTCTTCCGCATCTGCCTCCTCATCGCCCTCGCCTTCTCCATCTACCACGTCTTCCCACCACTCATC
CTCTTCGGCGAATGGCTATCACAGAACCATCCCTTCTCCAACCAAAGAGCCGTCGAGCAAGACTTCACCCCGACA
CCCAAGGAACTCGCCTGCCTGCACGGCCTGCCTCTTCCCGGAACCCTCGCGACGACCACAGAACAGACGCCGATA
CCAAACGTCGTCAACTTCGTCTTCTTCCAGCAGCTCCCTTCCAGCAAGCCAGAGGGAGACTTTGGCTTCCTCGCC
TACCTCGCCGTCCGGAGCGCCATAGTCTCCCTGAAGCCCGACCATGTCTACATCCACTACGGCTTTGCCTCCTCG
CCTTCGCGCTTCGGTCGTGTCTCTCAGGCGCCGCTCGGCGAGAGCATCATCATGCGCAATCCCTGGATCCGACGA
CTGAGGCCGCATGTCGAGCTGAAGCCATACACGAAGCCCTTTGATCGCTCCCTCAAGCATAGAGAGCACCTCGCC
GACCGCGTTCGACTCGAGATTTTACTCCAACACGGCGGCATCTACATGGATCTGGACGCCTTTGCCCTCCGGCCT
TTTGCAGAAGCGCTCTCGCCCTCGCCGCCTCACGATGCTATCCTCGGTTATGAAGGCGGTAACCGCGCCGGTCTA
TGCAACGCCGTCATCGCCGCTCGACCAAACAGCTCCTTTATCCATCGCTGGCTTCACACGTATGACAAGGCCGAC
CTCAACGCCGAGTGGAACTACCACAGCGTTATCCTCCCGCGCCAGCTCGCCCACAATCACCCAGACGAAGTCTGC
GAGCTGCCTCCCGATGCCTTCTTCTGGCCGACCTGGACATGGGGCGACGTTCGGTGGATGCATGAGCCCCTGAGC
CCGCCGGATGCCGAGTTCTGGAAGGGCCGAATACAGGAGTTGGGCGGTAGCTTGTTCCCGAATCAGCTCGTCTAT
CATGCCTGGAGCCAGATGAGCAGGAACCGCTATCTGAAACGCCTGAGGCCGGATGTCATCCGTGCGGAAAACACG
AGGTTCAATCTGCTTATGAGACGTTTTCTGGAGGATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail