Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01608
Gene name
Locationscaffold_01:5476793..5477885
Strand+
Gene length (bp)1092
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 6.0E-08 161 204

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1993 0.16 0.2041 0.2204 0.0959 0.0105 0.6047 0.1818 0.7944 0.0156

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup201
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7636
Ophiocordyceps australis map64 (Brazil) OphauB2|2476
Ophiocordyceps australis map64 (Brazil) OphauB2|3326
Ophiocordyceps camponoti-floridani Ophcf2|01608 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02341
Ophiocordyceps camponoti-rufipedis Ophun1|1578
Ophiocordyceps camponoti-rufipedis Ophun1|1921
Ophiocordyceps kimflemingae Ophio5|1705
Ophiocordyceps kimflemingae Ophio5|3099
Ophiocordyceps subramaniannii Hirsu2|10364
Ophiocordyceps subramaniannii Hirsu2|7127

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01608
MVSLFRICLLIALAFSIYHVFPPLILFGEWLSQNHPFSNQRAVEQDFTPTPKELACLHGLPLPGTLATTTEQTPI
PNVVNFVFFQQLPSSKPEGDFGFLAYLAVRSAIVSLKPDHVYIHYGFASSPSRFGRVSQAPLGESIIMRNPWIRR
LRPHVELKPYTKPFDRSLKHREHLADRVRLEILLQHGGIYMDLDAFALRPFAEALSPSPPHDAILGYEGGNRAGL
CNAVIAARPNSSFIHRWLHTYDKADLNAEWNYHSVILPRQLAHNHPDEVCELPPDAFFWPTWTWGDVRWMHEPLS
PPDAEFWKGRIQELGGSLFPNQLVYHAWSQMSRNRYLKRLRPDVIRAENTRFNLLMRRFLEDD*
Coding >Ophcf2|01608
ATGGTCTCCCTCTTCCGCATCTGCCTCCTCATCGCCCTCGCCTTCTCCATCTACCACGTCTTCCCACCACTCATC
CTCTTCGGCGAATGGCTATCACAGAACCATCCCTTCTCCAACCAAAGAGCCGTCGAGCAAGACTTCACCCCGACA
CCCAAGGAACTCGCCTGCCTGCACGGCCTGCCTCTTCCCGGAACCCTCGCGACGACCACAGAACAGACGCCGATA
CCAAACGTCGTCAACTTCGTCTTCTTCCAGCAGCTCCCTTCCAGCAAGCCAGAGGGAGACTTTGGCTTCCTCGCC
TACCTCGCCGTCCGGAGCGCCATAGTCTCCCTGAAGCCCGACCATGTCTACATCCACTACGGCTTTGCCTCCTCG
CCTTCGCGCTTCGGTCGTGTCTCTCAGGCGCCGCTCGGCGAGAGCATCATCATGCGCAATCCCTGGATCCGACGA
CTGAGGCCGCATGTCGAGCTGAAGCCATACACGAAGCCCTTTGATCGCTCCCTCAAGCATAGAGAGCACCTCGCC
GACCGCGTTCGACTCGAGATTTTACTCCAACACGGCGGCATCTACATGGATCTGGACGCCTTTGCCCTCCGGCCT
TTTGCAGAAGCGCTCTCGCCCTCGCCGCCTCACGATGCTATCCTCGGTTATGAAGGCGGTAACCGCGCCGGTCTA
TGCAACGCCGTCATCGCCGCTCGACCAAACAGCTCCTTTATCCATCGCTGGCTTCACACGTATGACAAGGCCGAC
CTCAACGCCGAGTGGAACTACCACAGCGTTATCCTCCCGCGCCAGCTCGCCCACAATCACCCAGACGAAGTCTGC
GAGCTGCCTCCCGATGCCTTCTTCTGGCCGACCTGGACATGGGGCGACGTTCGGTGGATGCATGAGCCCCTGAGC
CCGCCGGATGCCGAGTTCTGGAAGGGCCGAATACAGGAGTTGGGCGGTAGCTTGTTCCCGAATCAGCTCGTCTAT
CATGCCTGGAGCCAGATGAGCAGGAACCGCTATCTGAAACGCCTGAGGCCGGATGTCATCCGTGCGGAAAACACG
AGGTTCAATCTGCTTATGAGACGTTTTCTGGAGGATGACTGA
Transcript >Ophcf2|01608
ATGGTCTCCCTCTTCCGCATCTGCCTCCTCATCGCCCTCGCCTTCTCCATCTACCACGTCTTCCCACCACTCATC
CTCTTCGGCGAATGGCTATCACAGAACCATCCCTTCTCCAACCAAAGAGCCGTCGAGCAAGACTTCACCCCGACA
CCCAAGGAACTCGCCTGCCTGCACGGCCTGCCTCTTCCCGGAACCCTCGCGACGACCACAGAACAGACGCCGATA
CCAAACGTCGTCAACTTCGTCTTCTTCCAGCAGCTCCCTTCCAGCAAGCCAGAGGGAGACTTTGGCTTCCTCGCC
TACCTCGCCGTCCGGAGCGCCATAGTCTCCCTGAAGCCCGACCATGTCTACATCCACTACGGCTTTGCCTCCTCG
CCTTCGCGCTTCGGTCGTGTCTCTCAGGCGCCGCTCGGCGAGAGCATCATCATGCGCAATCCCTGGATCCGACGA
CTGAGGCCGCATGTCGAGCTGAAGCCATACACGAAGCCCTTTGATCGCTCCCTCAAGCATAGAGAGCACCTCGCC
GACCGCGTTCGACTCGAGATTTTACTCCAACACGGCGGCATCTACATGGATCTGGACGCCTTTGCCCTCCGGCCT
TTTGCAGAAGCGCTCTCGCCCTCGCCGCCTCACGATGCTATCCTCGGTTATGAAGGCGGTAACCGCGCCGGTCTA
TGCAACGCCGTCATCGCCGCTCGACCAAACAGCTCCTTTATCCATCGCTGGCTTCACACGTATGACAAGGCCGAC
CTCAACGCCGAGTGGAACTACCACAGCGTTATCCTCCCGCGCCAGCTCGCCCACAATCACCCAGACGAAGTCTGC
GAGCTGCCTCCCGATGCCTTCTTCTGGCCGACCTGGACATGGGGCGACGTTCGGTGGATGCATGAGCCCCTGAGC
CCGCCGGATGCCGAGTTCTGGAAGGGCCGAATACAGGAGTTGGGCGGTAGCTTGTTCCCGAATCAGCTCGTCTAT
CATGCCTGGAGCCAGATGAGCAGGAACCGCTATCTGAAACGCCTGAGGCCGGATGTCATCCGTGCGGAAAACACG
AGGTTCAATCTGCTTATGAGACGTTTTCTGGAGGATGACTGA
Gene >Ophcf2|01608
ATGGTCTCCCTCTTCCGCATCTGCCTCCTCATCGCCCTCGCCTTCTCCATCTACCACGTCTTCCCACCACTCATC
CTCTTCGGCGAATGGCTATCACAGAACCATCCCTTCTCCAACCAAAGAGCCGTCGAGCAAGACTTCACCCCGACA
CCCAAGGAACTCGCCTGCCTGCACGGCCTGCCTCTTCCCGGAACCCTCGCGACGACCACAGAACAGACGCCGATA
CCAAACGTCGTCAACTTCGTCTTCTTCCAGCAGCTCCCTTCCAGCAAGCCAGAGGGAGACTTTGGCTTCCTCGCC
TACCTCGCCGTCCGGAGCGCCATAGTCTCCCTGAAGCCCGACCATGTCTACATCCACTACGGCTTTGCCTCCTCG
CCTTCGCGCTTCGGTCGTGTCTCTCAGGCGCCGCTCGGCGAGAGCATCATCATGCGCAATCCCTGGATCCGACGA
CTGAGGCCGCATGTCGAGCTGAAGCCATACACGAAGCCCTTTGATCGCTCCCTCAAGCATAGAGAGCACCTCGCC
GACCGCGTTCGACTCGAGATTTTACTCCAACACGGCGGCATCTACATGGATCTGGACGCCTTTGCCCTCCGGCCT
TTTGCAGAAGCGCTCTCGCCCTCGCCGCCTCACGATGCTATCCTCGGTTATGAAGGCGGTAACCGCGCCGGTCTA
TGCAACGCCGTCATCGCCGCTCGACCAAACAGCTCCTTTATCCATCGCTGGCTTCACACGTATGACAAGGCCGAC
CTCAACGCCGAGTGGAACTACCACAGCGTTATCCTCCCGCGCCAGCTCGCCCACAATCACCCAGACGAAGTCTGC
GAGCTGCCTCCCGATGCCTTCTTCTGGCCGACCTGGACATGGGGCGACGTTCGGTGGATGCATGAGCCCCTGAGC
CCGCCGGATGCCGAGTTCTGGAAGGGCCGAATACAGGAGTTGGGCGGTAGCTTGTTCCCGAATCAGCTCGTCTAT
CATGCCTGGAGCCAGATGAGCAGGAACCGCTATCTGAAACGCCTGAGGCCGGATGTCATCCGTGCGGAAAACACG
AGGTTCAATCTGCTTATGAGACGTTTTCTGGAGGATGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail