Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01607
Gene name
Locationscaffold_01:5473744..5476180
Strand+
Gene length (bp)2436
Transcript length (bp)2436
Coding sequence length (bp)2436
Protein length (aa) 812

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain 1.2E-32 700 801
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 3.9E-10 155 252

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.4094 0.4679 0.6489 0.17 0.0897 0.0217 0.0621 0.4619 0.4378 0.0178

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH2 7.3E-59 28 610

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2977
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7021
Ophiocordyceps australis map64 (Brazil) OphauB2|7701
Ophiocordyceps camponoti-floridani Ophcf2|01607 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1577
Ophiocordyceps kimflemingae Ophio5|3098
Ophiocordyceps subramaniannii Hirsu2|5087

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01607
MGCLLASGVYNDSHLWYSDNLKRIDSSQFSVPWIYRSEFSLSTKRGQHYLLQTHGITARADIYLNGKQIANSSLQ
SGSFGGHTYDVTDVVTRDNAVAIVAYPGDFSYDLIQGFVDWNPSPPDNLTGVWRDVFVKQTGPVSMGSVSVSIDH
LAPASAALITVRAEAKNLQHHEVRLLVKSKITDPAGSHKFLRATILRLPPNRSALVELSHKIRKPRVWWPKQWGQ
QPLYTSELVFLVDSAVSDVTRQPFGIRTVTSSLNKHNDTVFRINGRPFQVLGGGYAPDQFLRWDRERFLTIARYT
LDMGLNTIRLEGMLEHPELYQIADELGIMILPGWVCCSKWEAWKHNHDLDIKPIPYWHERDYKTAAASMANEVAM
LRNHPSILGFLIGSDSWPDDRATGIYLDALRAVFWQMPVIASAAKRGHAQTMQPSGMKMDGPYDWVPPNYWYDTG
DRLGVAFGFGSELGSGVGTPEYASLAGFLSAGELEGLWRGPDDDLFHMSTSKSSFTNRSIYNQALSQRYGRPDSL
EDYLWKCQMMDYEATRAQNEAYATRWNGKRPATGSIYWMLNSAWPSLHWSLFDHLMNPAGAYFGAKTAGRLHHVA
YDYVDRSVWLVDRSLDRRGLRTVTVDVMDLAGTTVYKRRVKAISRGNTAVRVADLSGVAYTDALVLLRLLLCDER
GRSLSRNVYWISRGVDVLDWNRSTWYHTPVSRFANFKDLSSMKRAKVLAKASPTGAKTMTVELKNESPVPAFFVR
LSAVDESGDEVTPVIWSDNYVTLWPLERVRVDVELFEVLAGVRVRIRGWNVGWAVVDDGGG*
Coding >Ophcf2|01607
ATGGGCTGTCTGCTGGCCTCGGGCGTCTACAACGATTCGCATCTCTGGTACTCTGACAATCTCAAGAGAATCGAC
AGCAGCCAGTTCTCCGTGCCCTGGATTTACAGGAGTGAATTCTCGCTGTCGACGAAAAGGGGGCAGCACTATCTC
TTGCAAACACACGGCATCACCGCCCGGGCGGACATTTACCTCAATGGCAAGCAGATAGCAAACTCGAGCTTACAA
TCCGGCTCGTTCGGGGGTCACACGTACGACGTTACCGACGTGGTTACGCGCGATAACGCCGTGGCTATCGTCGCC
TATCCCGGAGACTTTAGCTACGACCTCATACAGGGCTTCGTGGACTGGAACCCATCGCCTCCGGATAACTTGACA
GGAGTCTGGCGCGATGTCTTTGTTAAGCAGACCGGCCCGGTGAGTATGGGGTCAGTAAGCGTCTCTATAGATCAT
CTGGCCCCGGCCTCGGCGGCGCTCATCACTGTACGTGCTGAGGCGAAGAACCTGCAACACCACGAGGTGCGGCTC
CTAGTCAAGTCGAAGATTACGGATCCTGCTGGAAGCCACAAGTTCCTTCGAGCCACCATTCTAAGGCTGCCACCT
AATCGATCCGCTCTCGTTGAACTTTCGCACAAGATCAGGAAGCCTAGGGTCTGGTGGCCGAAGCAATGGGGTCAG
CAGCCCCTTTACACCTCCGAGCTAGTCTTCCTCGTCGACTCTGCAGTCTCAGACGTAACCCGGCAGCCATTCGGC
ATCCGCACCGTCACGTCCAGTCTCAACAAACACAACGACACCGTTTTTCGGATAAATGGCAGGCCATTCCAGGTC
TTGGGAGGCGGATATGCGCCCGATCAATTCCTCCGCTGGGACAGAGAACGCTTCCTCACGATAGCGAGATACACG
CTCGACATGGGACTGAACACGATTCGGCTCGAGGGCATGCTCGAGCACCCAGAGCTGTATCAGATAGCAGACGAG
CTGGGCATCATGATATTACCCGGATGGGTCTGCTGCTCCAAATGGGAGGCGTGGAAGCACAATCACGACCTAGAC
ATTAAGCCGATTCCTTACTGGCACGAGAGAGACTACAAGACAGCAGCCGCTAGCATGGCGAACGAAGTCGCCATG
CTTCGAAACCACCCCAGCATTCTTGGCTTCCTCATCGGCAGCGACTCGTGGCCAGACGACCGTGCCACCGGCATC
TACCTCGACGCCCTAAGAGCCGTCTTCTGGCAGATGCCCGTCATCGCGTCGGCGGCCAAGCGGGGACATGCCCAG
ACGATGCAGCCGAGCGGCATGAAGATGGACGGGCCGTACGATTGGGTGCCGCCAAACTACTGGTATGACACTGGG
GATCGGCTCGGAGTTGCTTTCGGGTTCGGATCTGAGCTGGGGTCTGGCGTGGGGACCCCTGAGTATGCTAGCTTG
GCTGGTTTCCTCTCTGCTGGAGAGTTGGAGGGTCTCTGGAGAGGGCCAGACGATGATCTGTTTCACATGTCGACC
AGTAAATCATCCTTTACGAACCGGAGCATCTACAATCAGGCCCTGTCCCAGAGATACGGACGCCCAGACTCGCTG
GAAGACTACCTTTGGAAGTGCCAGATGATGGACTACGAAGCAACCCGCGCCCAGAACGAAGCCTACGCGACTCGC
TGGAACGGCAAGCGGCCAGCCACTGGATCCATCTACTGGATGCTCAATAGCGCCTGGCCATCCCTTCACTGGAGC
CTGTTCGACCACCTCATGAACCCGGCCGGAGCCTACTTTGGAGCCAAGACGGCGGGCCGGCTGCATCACGTTGCT
TACGACTACGTGGATCGGAGTGTATGGCTCGTCGACCGCTCGCTGGATAGACGTGGGTTGCGGACGGTCACCGTT
GATGTCATGGACTTGGCCGGGACGACTGTCTATAAGAGAAGGGTGAAGGCGATTTCAAGAGGGAACACGGCTGTC
CGGGTCGCGGATCTTTCTGGAGTGGCTTATACGGATGCCCTTGTTCTTTTGCGGCTGCTTCTCTGCGACGAACGA
GGCAGATCGTTGAGCCGCAACGTCTACTGGATCTCGAGAGGAGTCGACGTATTGGACTGGAACCGCTCAACATGG
TATCACACGCCCGTCAGCAGATTCGCAAACTTTAAGGACTTGAGCAGCATGAAAAGGGCAAAAGTGCTCGCCAAG
GCATCACCGACCGGCGCAAAGACCATGACCGTAGAGCTAAAGAACGAATCCCCCGTGCCGGCATTCTTCGTCCGG
CTCAGCGCGGTGGACGAGAGCGGCGACGAGGTGACGCCCGTGATCTGGTCAGATAATTACGTGACGCTGTGGCCG
CTGGAGCGAGTGCGGGTTGACGTCGAATTGTTTGAGGTGTTGGCCGGGGTGAGGGTGCGGATTAGGGGATGGAAT
GTGGGATGGGCTGTGGTGGATGATGGTGGTGGATGA
Transcript >Ophcf2|01607
ATGGGCTGTCTGCTGGCCTCGGGCGTCTACAACGATTCGCATCTCTGGTACTCTGACAATCTCAAGAGAATCGAC
AGCAGCCAGTTCTCCGTGCCCTGGATTTACAGGAGTGAATTCTCGCTGTCGACGAAAAGGGGGCAGCACTATCTC
TTGCAAACACACGGCATCACCGCCCGGGCGGACATTTACCTCAATGGCAAGCAGATAGCAAACTCGAGCTTACAA
TCCGGCTCGTTCGGGGGTCACACGTACGACGTTACCGACGTGGTTACGCGCGATAACGCCGTGGCTATCGTCGCC
TATCCCGGAGACTTTAGCTACGACCTCATACAGGGCTTCGTGGACTGGAACCCATCGCCTCCGGATAACTTGACA
GGAGTCTGGCGCGATGTCTTTGTTAAGCAGACCGGCCCGGTGAGTATGGGGTCAGTAAGCGTCTCTATAGATCAT
CTGGCCCCGGCCTCGGCGGCGCTCATCACTGTACGTGCTGAGGCGAAGAACCTGCAACACCACGAGGTGCGGCTC
CTAGTCAAGTCGAAGATTACGGATCCTGCTGGAAGCCACAAGTTCCTTCGAGCCACCATTCTAAGGCTGCCACCT
AATCGATCCGCTCTCGTTGAACTTTCGCACAAGATCAGGAAGCCTAGGGTCTGGTGGCCGAAGCAATGGGGTCAG
CAGCCCCTTTACACCTCCGAGCTAGTCTTCCTCGTCGACTCTGCAGTCTCAGACGTAACCCGGCAGCCATTCGGC
ATCCGCACCGTCACGTCCAGTCTCAACAAACACAACGACACCGTTTTTCGGATAAATGGCAGGCCATTCCAGGTC
TTGGGAGGCGGATATGCGCCCGATCAATTCCTCCGCTGGGACAGAGAACGCTTCCTCACGATAGCGAGATACACG
CTCGACATGGGACTGAACACGATTCGGCTCGAGGGCATGCTCGAGCACCCAGAGCTGTATCAGATAGCAGACGAG
CTGGGCATCATGATATTACCCGGATGGGTCTGCTGCTCCAAATGGGAGGCGTGGAAGCACAATCACGACCTAGAC
ATTAAGCCGATTCCTTACTGGCACGAGAGAGACTACAAGACAGCAGCCGCTAGCATGGCGAACGAAGTCGCCATG
CTTCGAAACCACCCCAGCATTCTTGGCTTCCTCATCGGCAGCGACTCGTGGCCAGACGACCGTGCCACCGGCATC
TACCTCGACGCCCTAAGAGCCGTCTTCTGGCAGATGCCCGTCATCGCGTCGGCGGCCAAGCGGGGACATGCCCAG
ACGATGCAGCCGAGCGGCATGAAGATGGACGGGCCGTACGATTGGGTGCCGCCAAACTACTGGTATGACACTGGG
GATCGGCTCGGAGTTGCTTTCGGGTTCGGATCTGAGCTGGGGTCTGGCGTGGGGACCCCTGAGTATGCTAGCTTG
GCTGGTTTCCTCTCTGCTGGAGAGTTGGAGGGTCTCTGGAGAGGGCCAGACGATGATCTGTTTCACATGTCGACC
AGTAAATCATCCTTTACGAACCGGAGCATCTACAATCAGGCCCTGTCCCAGAGATACGGACGCCCAGACTCGCTG
GAAGACTACCTTTGGAAGTGCCAGATGATGGACTACGAAGCAACCCGCGCCCAGAACGAAGCCTACGCGACTCGC
TGGAACGGCAAGCGGCCAGCCACTGGATCCATCTACTGGATGCTCAATAGCGCCTGGCCATCCCTTCACTGGAGC
CTGTTCGACCACCTCATGAACCCGGCCGGAGCCTACTTTGGAGCCAAGACGGCGGGCCGGCTGCATCACGTTGCT
TACGACTACGTGGATCGGAGTGTATGGCTCGTCGACCGCTCGCTGGATAGACGTGGGTTGCGGACGGTCACCGTT
GATGTCATGGACTTGGCCGGGACGACTGTCTATAAGAGAAGGGTGAAGGCGATTTCAAGAGGGAACACGGCTGTC
CGGGTCGCGGATCTTTCTGGAGTGGCTTATACGGATGCCCTTGTTCTTTTGCGGCTGCTTCTCTGCGACGAACGA
GGCAGATCGTTGAGCCGCAACGTCTACTGGATCTCGAGAGGAGTCGACGTATTGGACTGGAACCGCTCAACATGG
TATCACACGCCCGTCAGCAGATTCGCAAACTTTAAGGACTTGAGCAGCATGAAAAGGGCAAAAGTGCTCGCCAAG
GCATCACCGACCGGCGCAAAGACCATGACCGTAGAGCTAAAGAACGAATCCCCCGTGCCGGCATTCTTCGTCCGG
CTCAGCGCGGTGGACGAGAGCGGCGACGAGGTGACGCCCGTGATCTGGTCAGATAATTACGTGACGCTGTGGCCG
CTGGAGCGAGTGCGGGTTGACGTCGAATTGTTTGAGGTGTTGGCCGGGGTGAGGGTGCGGATTAGGGGATGGAAT
GTGGGATGGGCTGTGGTGGATGATGGTGGTGGATGA
Gene >Ophcf2|01607
ATGGGCTGTCTGCTGGCCTCGGGCGTCTACAACGATTCGCATCTCTGGTACTCTGACAATCTCAAGAGAATCGAC
AGCAGCCAGTTCTCCGTGCCCTGGATTTACAGGAGTGAATTCTCGCTGTCGACGAAAAGGGGGCAGCACTATCTC
TTGCAAACACACGGCATCACCGCCCGGGCGGACATTTACCTCAATGGCAAGCAGATAGCAAACTCGAGCTTACAA
TCCGGCTCGTTCGGGGGTCACACGTACGACGTTACCGACGTGGTTACGCGCGATAACGCCGTGGCTATCGTCGCC
TATCCCGGAGACTTTAGCTACGACCTCATACAGGGCTTCGTGGACTGGAACCCATCGCCTCCGGATAACTTGACA
GGAGTCTGGCGCGATGTCTTTGTTAAGCAGACCGGCCCGGTGAGTATGGGGTCAGTAAGCGTCTCTATAGATCAT
CTGGCCCCGGCCTCGGCGGCGCTCATCACTGTACGTGCTGAGGCGAAGAACCTGCAACACCACGAGGTGCGGCTC
CTAGTCAAGTCGAAGATTACGGATCCTGCTGGAAGCCACAAGTTCCTTCGAGCCACCATTCTAAGGCTGCCACCT
AATCGATCCGCTCTCGTTGAACTTTCGCACAAGATCAGGAAGCCTAGGGTCTGGTGGCCGAAGCAATGGGGTCAG
CAGCCCCTTTACACCTCCGAGCTAGTCTTCCTCGTCGACTCTGCAGTCTCAGACGTAACCCGGCAGCCATTCGGC
ATCCGCACCGTCACGTCCAGTCTCAACAAACACAACGACACCGTTTTTCGGATAAATGGCAGGCCATTCCAGGTC
TTGGGAGGCGGATATGCGCCCGATCAATTCCTCCGCTGGGACAGAGAACGCTTCCTCACGATAGCGAGATACACG
CTCGACATGGGACTGAACACGATTCGGCTCGAGGGCATGCTCGAGCACCCAGAGCTGTATCAGATAGCAGACGAG
CTGGGCATCATGATATTACCCGGATGGGTCTGCTGCTCCAAATGGGAGGCGTGGAAGCACAATCACGACCTAGAC
ATTAAGCCGATTCCTTACTGGCACGAGAGAGACTACAAGACAGCAGCCGCTAGCATGGCGAACGAAGTCGCCATG
CTTCGAAACCACCCCAGCATTCTTGGCTTCCTCATCGGCAGCGACTCGTGGCCAGACGACCGTGCCACCGGCATC
TACCTCGACGCCCTAAGAGCCGTCTTCTGGCAGATGCCCGTCATCGCGTCGGCGGCCAAGCGGGGACATGCCCAG
ACGATGCAGCCGAGCGGCATGAAGATGGACGGGCCGTACGATTGGGTGCCGCCAAACTACTGGTATGACACTGGG
GATCGGCTCGGAGTTGCTTTCGGGTTCGGATCTGAGCTGGGGTCTGGCGTGGGGACCCCTGAGTATGCTAGCTTG
GCTGGTTTCCTCTCTGCTGGAGAGTTGGAGGGTCTCTGGAGAGGGCCAGACGATGATCTGTTTCACATGTCGACC
AGTAAATCATCCTTTACGAACCGGAGCATCTACAATCAGGCCCTGTCCCAGAGATACGGACGCCCAGACTCGCTG
GAAGACTACCTTTGGAAGTGCCAGATGATGGACTACGAAGCAACCCGCGCCCAGAACGAAGCCTACGCGACTCGC
TGGAACGGCAAGCGGCCAGCCACTGGATCCATCTACTGGATGCTCAATAGCGCCTGGCCATCCCTTCACTGGAGC
CTGTTCGACCACCTCATGAACCCGGCCGGAGCCTACTTTGGAGCCAAGACGGCGGGCCGGCTGCATCACGTTGCT
TACGACTACGTGGATCGGAGTGTATGGCTCGTCGACCGCTCGCTGGATAGACGTGGGTTGCGGACGGTCACCGTT
GATGTCATGGACTTGGCCGGGACGACTGTCTATAAGAGAAGGGTGAAGGCGATTTCAAGAGGGAACACGGCTGTC
CGGGTCGCGGATCTTTCTGGAGTGGCTTATACGGATGCCCTTGTTCTTTTGCGGCTGCTTCTCTGCGACGAACGA
GGCAGATCGTTGAGCCGCAACGTCTACTGGATCTCGAGAGGAGTCGACGTATTGGACTGGAACCGCTCAACATGG
TATCACACGCCCGTCAGCAGATTCGCAAACTTTAAGGACTTGAGCAGCATGAAAAGGGCAAAAGTGCTCGCCAAG
GCATCACCGACCGGCGCAAAGACCATGACCGTAGAGCTAAAGAACGAATCCCCCGTGCCGGCATTCTTCGTCCGG
CTCAGCGCGGTGGACGAGAGCGGCGACGAGGTGACGCCCGTGATCTGGTCAGATAATTACGTGACGCTGTGGCCG
CTGGAGCGAGTGCGGGTTGACGTCGAATTGTTTGAGGTGTTGGCCGGGGTGAGGGTGCGGATTAGGGGATGGAAT
GTGGGATGGGCTGTGGTGGATGATGGTGGTGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail