Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01606
Gene name
Locationscaffold_01:5471411..5473058
Strand+
Gene length (bp)1647
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16499 Melibiase_2 Alpha galactosidase A 1.4E-50 30 310
PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain 1.1E-11 324 406
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 8.3E-07 416 510

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1216 0.0848 0.9462 0.0465 0.0888 0.0802 0.3165 0.3476 0.1602 0.0078

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999684

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH27 1.6E-28 32 318

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5336
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1421
Ophiocordyceps australis map64 (Brazil) OphauB2|7700
Ophiocordyceps camponoti-floridani Ophcf2|01606 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1576
Ophiocordyceps kimflemingae Ophio5|6817
Ophiocordyceps subramaniannii Hirsu2|5089

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01606
MQRPMWFLALAAALISPGSAIPAERLLPLPPMGFNNWARYQTNISESIFVDAAEAMIRTGLLAARYNRINLDDAW
STNARAASRSLVWDPVKFPRGFPWLTQHLKSQGFLPGIYSDAGGLSCAGYPGSLDYEDVDLKDFTAWGFKFLKMD
GCNLPDGSEATYHSIYGRWHRLLSESNSNIIFSDSAPAYFSNVPDLTNWYASIGWAREYGHLARHSGDIQTYPKG
RSWDTVMFIYRQHLRLARFQKPGFFNDPDFLNVDHPSYSMDEKKSHFALWCVFSAPLLLSADLTALSNAEIQYLT
NHRLINVNQDSLVQQATLVSSGTTWDVLTKSVDNGDRVVAVLNKGDSPASVFVSWERLGFSLVTLQRVEFVTVQD
LWTGKRRQARVSLKGISVTAVPSHGTAVYRISQRASGITPTGLIFNSNNLKCLTDHWSGLVTWSVCDGSDAQVWK
VYPEGLVNSLLQPAGCLMQIDQVFVSSRSPGRPCDKWKYYVSGNLINTRSGLCLTEGRDGVASTVPCGYLRNDQV
LSLPIGVVVLETGQRDRWTLGRA*
Coding >Ophcf2|01606
ATGCAACGGCCCATGTGGTTCCTGGCGCTGGCCGCAGCCCTCATCAGCCCCGGCTCCGCCATCCCGGCCGAGCGG
CTTCTCCCTCTTCCTCCTATGGGCTTCAACAACTGGGCTCGCTACCAGACGAACATTAGCGAATCCATCTTCGTC
GACGCCGCCGAGGCCATGATCAGGACTGGCCTCTTGGCTGCCAGATACAACCGCATAAACCTCGACGATGCCTGG
TCGACCAATGCACGAGCAGCCAGCAGATCCCTGGTCTGGGACCCGGTCAAGTTCCCGAGGGGGTTCCCTTGGCTC
ACGCAGCACTTAAAGTCACAGGGCTTCCTGCCTGGCATCTATAGCGACGCTGGCGGCTTATCCTGTGCCGGCTAC
CCGGGCTCTCTCGACTACGAGGACGTTGATCTCAAGGACTTTACAGCCTGGGGCTTCAAGTTCCTCAAGATGGAC
GGCTGCAATCTCCCGGACGGCAGTGAGGCGACCTACCACTCGATATACGGCCGCTGGCACAGGCTGCTCTCCGAG
TCCAACAGCAACATCATCTTCTCCGACTCCGCCCCGGCTTACTTCTCCAACGTCCCGGACCTGACAAACTGGTAT
GCCTCCATCGGCTGGGCCCGTGAATACGGCCATCTCGCCCGTCACAGCGGCGACATCCAGACTTACCCGAAGGGC
CGGTCGTGGGACACGGTCATGTTCATCTACAGACAGCACTTGCGTCTGGCTCGCTTCCAGAAGCCGGGCTTCTTC
AACGACCCGGACTTCCTCAACGTCGATCACCCGTCTTACAGCATGGATGAGAAGAAGAGCCACTTTGCGCTGTGG
TGCGTCTTCTCGGCGCCGCTGCTGCTCAGTGCCGACCTGACAGCCCTGTCAAACGCCGAGATTCAGTATCTGACC
AACCACCGGCTCATAAACGTCAACCAAGACAGTCTGGTTCAGCAGGCCACGCTCGTGAGCTCCGGCACTACGTGG
GATGTTCTCACCAAGAGCGTCGACAACGGCGATCGGGTTGTCGCCGTGCTTAACAAGGGCGACTCGCCTGCCAGT
GTCTTCGTCTCCTGGGAGAGGCTCGGCTTCTCGCTGGTCACCCTCCAGAGAGTCGAATTCGTTACCGTCCAAGAT
CTCTGGACCGGAAAGCGCCGGCAGGCTCGGGTGAGCCTCAAGGGAATCTCCGTCACAGCAGTCCCCTCCCACGGC
ACCGCCGTCTATCGTATCTCGCAAAGGGCCAGTGGCATCACGCCTACGGGCCTCATCTTCAACTCCAATAACCTC
AAGTGCCTCACCGATCATTGGTCAGGTCTGGTCACTTGGTCCGTCTGCGACGGCTCCGATGCCCAGGTCTGGAAG
GTCTACCCGGAAGGCCTGGTAAACAGCCTGCTTCAGCCCGCCGGCTGTCTGATGCAGATCGATCAGGTCTTCGTC
TCGTCCCGCAGCCCGGGCCGCCCCTGCGATAAGTGGAAGTACTACGTCTCGGGCAACCTGATCAACACCAGGTCG
GGTCTTTGCCTCACGGAGGGGAGGGATGGGGTCGCTTCTACCGTTCCTTGTGGCTACCTGAGAAATGACCAGGTC
TTGAGCTTGCCTATCGGCGTTGTCGTGCTTGAGACGGGGCAACGTGACAGGTGGACTCTGGGGCGAGCATGA
Transcript >Ophcf2|01606
ATGCAACGGCCCATGTGGTTCCTGGCGCTGGCCGCAGCCCTCATCAGCCCCGGCTCCGCCATCCCGGCCGAGCGG
CTTCTCCCTCTTCCTCCTATGGGCTTCAACAACTGGGCTCGCTACCAGACGAACATTAGCGAATCCATCTTCGTC
GACGCCGCCGAGGCCATGATCAGGACTGGCCTCTTGGCTGCCAGATACAACCGCATAAACCTCGACGATGCCTGG
TCGACCAATGCACGAGCAGCCAGCAGATCCCTGGTCTGGGACCCGGTCAAGTTCCCGAGGGGGTTCCCTTGGCTC
ACGCAGCACTTAAAGTCACAGGGCTTCCTGCCTGGCATCTATAGCGACGCTGGCGGCTTATCCTGTGCCGGCTAC
CCGGGCTCTCTCGACTACGAGGACGTTGATCTCAAGGACTTTACAGCCTGGGGCTTCAAGTTCCTCAAGATGGAC
GGCTGCAATCTCCCGGACGGCAGTGAGGCGACCTACCACTCGATATACGGCCGCTGGCACAGGCTGCTCTCCGAG
TCCAACAGCAACATCATCTTCTCCGACTCCGCCCCGGCTTACTTCTCCAACGTCCCGGACCTGACAAACTGGTAT
GCCTCCATCGGCTGGGCCCGTGAATACGGCCATCTCGCCCGTCACAGCGGCGACATCCAGACTTACCCGAAGGGC
CGGTCGTGGGACACGGTCATGTTCATCTACAGACAGCACTTGCGTCTGGCTCGCTTCCAGAAGCCGGGCTTCTTC
AACGACCCGGACTTCCTCAACGTCGATCACCCGTCTTACAGCATGGATGAGAAGAAGAGCCACTTTGCGCTGTGG
TGCGTCTTCTCGGCGCCGCTGCTGCTCAGTGCCGACCTGACAGCCCTGTCAAACGCCGAGATTCAGTATCTGACC
AACCACCGGCTCATAAACGTCAACCAAGACAGTCTGGTTCAGCAGGCCACGCTCGTGAGCTCCGGCACTACGTGG
GATGTTCTCACCAAGAGCGTCGACAACGGCGATCGGGTTGTCGCCGTGCTTAACAAGGGCGACTCGCCTGCCAGT
GTCTTCGTCTCCTGGGAGAGGCTCGGCTTCTCGCTGGTCACCCTCCAGAGAGTCGAATTCGTTACCGTCCAAGAT
CTCTGGACCGGAAAGCGCCGGCAGGCTCGGGTGAGCCTCAAGGGAATCTCCGTCACAGCAGTCCCCTCCCACGGC
ACCGCCGTCTATCGTATCTCGCAAAGGGCCAGTGGCATCACGCCTACGGGCCTCATCTTCAACTCCAATAACCTC
AAGTGCCTCACCGATCATTGGTCAGGTCTGGTCACTTGGTCCGTCTGCGACGGCTCCGATGCCCAGGTCTGGAAG
GTCTACCCGGAAGGCCTGGTAAACAGCCTGCTTCAGCCCGCCGGCTGTCTGATGCAGATCGATCAGGTCTTCGTC
TCGTCCCGCAGCCCGGGCCGCCCCTGCGATAAGTGGAAGTACTACGTCTCGGGCAACCTGATCAACACCAGGTCG
GGTCTTTGCCTCACGGAGGGGAGGGATGGGGTCGCTTCTACCGTTCCTTGTGGCTACCTGAGAAATGACCAGGTC
TTGAGCTTGCCTATCGGCGTTGTCGTGCTTGAGACGGGGCAACGTGACAGGTGGACTCTGGGGCGAGCATGA
Gene >Ophcf2|01606
ATGCAACGGCCCATGTGGTTCCTGGCGCTGGCCGCAGCCCTCATCAGCCCCGGCTCCGCCATCCCGGCCGAGCGG
CTTCTCCCTCTTCCTCCTATGGGCTTCAACAACTGGGCTCGCTACCAGACGAACATTAGCGAATCCATCTTCGTC
GACGCCGCCGAGGCCATGATCAGGACTGGCCTCTTGGCTGCCAGATACAACCGCATAAACCTCGACGATGCCTGG
TCGACCAATGCACGAGCAGCCAGCAGATCCCTGGTCTGGGACCCGGTCAAGTTCCCGAGGGGGTTCCCTTGGCTC
ACGCAGCACTTAAAGTCACAGGGCTTCCTGCCTGGCATCTATAGCGACGCTGGCGGCTTATCCTGTGCCGGCTAC
CCGGGCTCTCTCGACTACGAGGACGTTGATCTCAAGGACTTTACAGCCTGGGGCTTCAAGTTCCTCAAGATGGAC
GGCTGCAATCTCCCGGACGGCAGTGAGGCGACCTACCACTCGATATACGGCCGCTGGCACAGGCTGCTCTCCGAG
TCCAACAGCAACATCATCTTCTCCGACTCCGCCCCGGCTTACTTCTCCAACGTCCCGGACCTGACAAACTGGTAT
GCCTCCATCGGCTGGGCCCGTGAATACGGCCATCTCGCCCGTCACAGCGGCGACATCCAGACTTACCCGAAGGGC
CGGTCGTGGGACACGGTCATGTTCATCTACAGACAGCACTTGCGTCTGGCTCGCTTCCAGAAGCCGGGCTTCTTC
AACGACCCGGACTTCCTCAACGTCGATCACCCGTCTTACAGCATGGATGAGAAGAAGAGCCACTTTGCGCTGTGG
TGCGTCTTCTCGGCGCCGCTGCTGCTCAGTGCCGACCTGACAGCCCTGTCAAACGCCGAGATTCAGTATCTGACC
AACCACCGGCTCATAAACGTCAACCAAGACAGTCTGGTTCAGCAGGCCACGCTCGTGAGCTCCGGCACTACGTGG
GATGTTCTCACCAAGAGCGTCGACAACGGCGATCGGGTTGTCGCCGTGCTTAACAAGGGCGACTCGCCTGCCAGT
GTCTTCGTCTCCTGGGAGAGGCTCGGCTTCTCGCTGGTCACCCTCCAGAGAGTCGAATTCGTTACCGTCCAAGAT
CTCTGGACCGGAAAGCGCCGGCAGGCTCGGGTGAGCCTCAAGGGAATCTCCGTCACAGCAGTCCCCTCCCACGGC
ACCGCCGTCTATCGTATCTCGCAAAGGGCCAGTGGCATCACGCCTACGGGCCTCATCTTCAACTCCAATAACCTC
AAGTGCCTCACCGATCATTGGTCAGGTCTGGTCACTTGGTCCGTCTGCGACGGCTCCGATGCCCAGGTCTGGAAG
GTCTACCCGGAAGGCCTGGTAAACAGCCTGCTTCAGCCCGCCGGCTGTCTGATGCAGATCGATCAGGTCTTCGTC
TCGTCCCGCAGCCCGGGCCGCCCCTGCGATAAGTGGAAGTACTACGTCTCGGGCAACCTGATCAACACCAGGTCG
GGTCTTTGCCTCACGGAGGGGAGGGATGGGGTCGCTTCTACCGTTCCTTGTGGCTACCTGAGAAATGACCAGGTC
TTGAGCTTGCCTATCGGCGTTGTCGTGCTTGAGACGGGGCAACGTGACAGGTGGACTCTGGGGCGAGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail