Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01603
Gene name
Locationscaffold_01:5465483..5466251
Strand+
Gene length (bp)768
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.5E-16 11 244
PF06259 Abhydrolase_8 Alpha/beta hydrolase 2.0E-04 60 94

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6362 0.4722 0.1892 0.0527 0.1075 0.0175 0.0839 0.3294 0.1339 0.0335

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3998
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4304
Ophiocordyceps australis map64 (Brazil) OphauB2|5646
Ophiocordyceps camponoti-floridani Ophcf2|01603 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1573
Ophiocordyceps kimflemingae Ophio5|6821
Ophiocordyceps subramaniannii Hirsu2|8015

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01603
MTISARDKAVLIITGYWHVPEQYSRVGSALERKGIRVISECLPTCQNLPPPHKTIHDDIQFIKDIVAKEVEEKTL
LTVLCHSYGGMVASAALGEFAVNAESSNKGGVTGIIYMSAFVPSENQSLSGKFGGRLPEFIKVRPDNTCFPEPPA
PVFFSDLSPEDADWAIGLVTRCPVGPLSTPIPGDRVAWRSIPSAYIFCEADVALPPKTQRSMVAAAKAQGAKFRV
YSLDTNHSPFVNKPEAVADIVVDVIQSREV*
Coding >Ophcf2|01603
ATGACCATCTCAGCGAGAGACAAGGCAGTCCTCATCATCACCGGCTACTGGCATGTCCCGGAACAGTATTCCCGA
GTCGGCTCGGCTCTCGAAAGAAAGGGCATCAGAGTCATATCCGAGTGTCTACCGACCTGTCAGAACCTCCCGCCT
CCTCACAAGACCATTCACGACGACATACAATTCATCAAGGACATCGTGGCCAAGGAAGTCGAGGAAAAGACGTTG
CTGACTGTGCTGTGCCACTCTTACGGGGGAATGGTCGCTTCTGCCGCCCTCGGCGAATTCGCCGTCAACGCAGAG
TCATCGAACAAGGGGGGCGTGACGGGCATCATCTACATGTCTGCCTTTGTGCCTTCGGAGAACCAGTCTCTCAGC
GGCAAGTTTGGCGGTCGACTTCCCGAATTCATCAAGGTACGGCCGGACAACACATGCTTCCCTGAACCCCCAGCC
CCCGTCTTCTTCAGCGACTTGTCTCCCGAGGACGCCGATTGGGCTATAGGCCTCGTCACCAGGTGTCCGGTCGGA
CCCTTGTCGACTCCCATCCCTGGGGACCGCGTGGCTTGGCGATCGATCCCTTCGGCCTACATCTTCTGCGAGGCT
GACGTCGCCTTACCACCCAAGACGCAGCGGTCAATGGTGGCGGCCGCCAAGGCTCAGGGGGCCAAATTCCGAGTG
TACAGCCTGGATACCAACCACAGTCCGTTCGTTAACAAGCCGGAAGCAGTTGCGGATATCGTCGTCGATGTCATT
CAGTCTCGTGAGGTCTGA
Transcript >Ophcf2|01603
ATGACCATCTCAGCGAGAGACAAGGCAGTCCTCATCATCACCGGCTACTGGCATGTCCCGGAACAGTATTCCCGA
GTCGGCTCGGCTCTCGAAAGAAAGGGCATCAGAGTCATATCCGAGTGTCTACCGACCTGTCAGAACCTCCCGCCT
CCTCACAAGACCATTCACGACGACATACAATTCATCAAGGACATCGTGGCCAAGGAAGTCGAGGAAAAGACGTTG
CTGACTGTGCTGTGCCACTCTTACGGGGGAATGGTCGCTTCTGCCGCCCTCGGCGAATTCGCCGTCAACGCAGAG
TCATCGAACAAGGGGGGCGTGACGGGCATCATCTACATGTCTGCCTTTGTGCCTTCGGAGAACCAGTCTCTCAGC
GGCAAGTTTGGCGGTCGACTTCCCGAATTCATCAAGGTACGGCCGGACAACACATGCTTCCCTGAACCCCCAGCC
CCCGTCTTCTTCAGCGACTTGTCTCCCGAGGACGCCGATTGGGCTATAGGCCTCGTCACCAGGTGTCCGGTCGGA
CCCTTGTCGACTCCCATCCCTGGGGACCGCGTGGCTTGGCGATCGATCCCTTCGGCCTACATCTTCTGCGAGGCT
GACGTCGCCTTACCACCCAAGACGCAGCGGTCAATGGTGGCGGCCGCCAAGGCTCAGGGGGCCAAATTCCGAGTG
TACAGCCTGGATACCAACCACAGTCCGTTCGTTAACAAGCCGGAAGCAGTTGCGGATATCGTCGTCGATGTCATT
CAGTCTCGTGAGGTCTGA
Gene >Ophcf2|01603
ATGACCATCTCAGCGAGAGACAAGGCAGTCCTCATCATCACCGGCTACTGGCATGTCCCGGAACAGTATTCCCGA
GTCGGCTCGGCTCTCGAAAGAAAGGGCATCAGAGTCATATCCGAGTGTCTACCGACCTGTCAGAACCTCCCGCCT
CCTCACAAGACCATTCACGACGACATACAATTCATCAAGGACATCGTGGCCAAGGAAGTCGAGGAAAAGACGTTG
CTGACTGTGCTGTGCCACTCTTACGGGGGAATGGTCGCTTCTGCCGCCCTCGGCGAATTCGCCGTCAACGCAGAG
TCATCGAACAAGGGGGGCGTGACGGGCATCATCTACATGTCTGCCTTTGTGCCTTCGGAGAACCAGTCTCTCAGC
GGCAAGTTTGGCGGTCGACTTCCCGAATTCATCAAGGTACGGCCGGACAACACATGCTTCCCTGAACCCCCAGCC
CCCGTCTTCTTCAGCGACTTGTCTCCCGAGGACGCCGATTGGGCTATAGGCCTCGTCACCAGGTGTCCGGTCGGA
CCCTTGTCGACTCCCATCCCTGGGGACCGCGTGGCTTGGCGATCGATCCCTTCGGCCTACATCTTCTGCGAGGCT
GACGTCGCCTTACCACCCAAGACGCAGCGGTCAATGGTGGCGGCCGCCAAGGCTCAGGGGGCCAAATTCCGAGTG
TACAGCCTGGATACCAACCACAGTCCGTTCGTTAACAAGCCGGAAGCAGTTGCGGATATCGTCGTCGATGTCATT
CAGTCTCGTGAGGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail