Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01602
Gene name
Locationscaffold_01:5463161..5464674
Strand+
Gene length (bp)1513
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 4.2E-54 67 461

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 92 114 22
2 147 169 22
3 179 201 22
4 208 230 22
5 250 269 19
6 289 311 22
7 331 353 22
8 373 395 22
9 400 422 22
10 439 461 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01602
MGIMEYSSEPDAKLAKSSSEPREETSSSSSDNVLGGSAIAGEVSEFEERRIDVEKQKTEAGDAHFHRLGWKRLTV
ILIVEAVALGSLSLPAAFATLGMVAGVVCCVGLGLIAIYTSDIVGQVKLKYPEVAHYADAGRLLMGRFGYELVGA
MFVLQLTFLVGSHTLTGTIAFLDITNNGACSVVFGFVSAVILLLLAIPPSFAEVAILGYIDFVSILAAIGITLIA
TGIIATDSPGGLAAVNWSAWPKPDINFAEAFIAIANIVFAYSFCMCQFSFMDEMHTPGDYLKSIWTLGIIEIIIY
TVTGAVIYAFVGIDVKSPALLSAGPLISKIAFGVALPVIFISGSINTTVVGRYIHGRIFRDSVTRFINTPRGWIT
WLAVITVITIAAFVIAEVIPFFSDLLSISSSLFVSGFTFYIPAMMWYKLLRVGPWYSRENLIHALMNGFCFIIGI
VVLVCGTYGSIDDIIHQFSEGKVRGVFACAPIA*
Coding >Ophcf2|01602
ATGGGCATAATGGAGTACTCGTCGGAGCCCGACGCGAAGCTGGCCAAGTCGAGCTCCGAGCCTCGAGAGGAGACG
TCGTCCTCCTCGTCGGACAATGTACTGGGAGGCAGCGCCATCGCCGGCGAGGTCAGCGAGTTCGAGGAGCGGCGC
ATCGACGTGGAGAAGCAAAAGACGGAGGCGGGCGACGCTCACTTCCATCGGCTGGGCTGGAAGCGACTGACCGTC
ATCCTCATCGTCGAGGCCGTTGCTCTCGGAAGCTTGAGTCTCCCCGCGGCCTTTGCCACGCTTGGAATGGTGGCT
GGCGTCGTTTGCTGCGTCGGACTGGGTCTCATCGCCATCTATACCAGCGACATCGTCGGTCAGGTCAAGCTCAAG
TATCCCGAAGTCGCTCACTATGCCGACGCCGGACGGTTGCTCATGGGTCGTTTCGGCTACGAGCTCGTGGGCGCC
ATGTTCGTCTTGCAGTTGACCTTTCTCGTCGGCTCTCACACGCTGACGGGAACCATCGCCTTCCTCGACATCACC
AACAACGGCGCCTGCTCCGTCGTCTTCGGCTTCGTCTCGGCCGTCATCTTGTTGTTGCTGGCGATCCCCCCTTCG
TTCGCAGAGGTCGCCATCCTGGGATACATCGACTTCGTTTCCATCCTCGCCGCCATCGGCATCACGCTCATCGCC
ACCGGAATCATCGCCACCGACTCCCCCGGCGGTTTAGCCGCTGTGAACTGGTCCGCGTGGCCGAAGCCCGACATC
AACTTCGCCGAGGCCTTCATCGCCATCGCCAACATCGTCTTCGCTTACAGCTTCTGCATGTGCCAATTCTCCTTC
ATGGACGAGATGCACACCCCCGGCGACTACCTCAAGTCCATCTGGACGCTGGGAATCATCGAGATCATCATCTAC
ACCGTCACCGGCGCCGTCATATATGCCTTTGTCGGTATCGACGTCAAGTCGCCCGCCCTGCTGTCGGCCGGCCCG
CTCATCTCCAAGATCGCCTTTGGAGTCGCGCTGCCCGTCATCTTCATCTCGGGATCCATCAATACCACCGTCGTC
GGCCGCTATATCCACGGCCGCATCTTTCGAGACTCCGTCACGCGCTTCATCAACACGCCCAGGGGCTGGATCACC
TGGCTGGCCGTCATCACCGTCATCACCATCGCCGCCTTTGTCATCGCCGAGGTCATCCCCTTCTTTTCTGACCTG
CTGTCCATCTCGTCCTCTCTCTTCGTCTCCGGCTTCACCTTTTATATCCCTGCCATGATGTGGTACAAGTTGCTC
CGGGTAGGGCCGTGGTATTCGCGCGAAAACCTGATTCACGCCTTGATGAACGGCTTCTGCTTCATCATCGGCATC
GTCGTCCTGGTCTGCGGCACATATGGCAGTATCGACGATATCATTCACCAATTCAGTGAAGGAAAGGTCCGCGGC
GTCTTTGCTTGCGCACCCATCGCGTAA
Transcript >Ophcf2|01602
ATGGGCATAATGGAGTACTCGTCGGAGCCCGACGCGAAGCTGGCCAAGTCGAGCTCCGAGCCTCGAGAGGAGACG
TCGTCCTCCTCGTCGGACAATGTACTGGGAGGCAGCGCCATCGCCGGCGAGGTCAGCGAGTTCGAGGAGCGGCGC
ATCGACGTGGAGAAGCAAAAGACGGAGGCGGGCGACGCTCACTTCCATCGGCTGGGCTGGAAGCGACTGACCGTC
ATCCTCATCGTCGAGGCCGTTGCTCTCGGAAGCTTGAGTCTCCCCGCGGCCTTTGCCACGCTTGGAATGGTGGCT
GGCGTCGTTTGCTGCGTCGGACTGGGTCTCATCGCCATCTATACCAGCGACATCGTCGGTCAGGTCAAGCTCAAG
TATCCCGAAGTCGCTCACTATGCCGACGCCGGACGGTTGCTCATGGGTCGTTTCGGCTACGAGCTCGTGGGCGCC
ATGTTCGTCTTGCAGTTGACCTTTCTCGTCGGCTCTCACACGCTGACGGGAACCATCGCCTTCCTCGACATCACC
AACAACGGCGCCTGCTCCGTCGTCTTCGGCTTCGTCTCGGCCGTCATCTTGTTGTTGCTGGCGATCCCCCCTTCG
TTCGCAGAGGTCGCCATCCTGGGATACATCGACTTCGTTTCCATCCTCGCCGCCATCGGCATCACGCTCATCGCC
ACCGGAATCATCGCCACCGACTCCCCCGGCGGTTTAGCCGCTGTGAACTGGTCCGCGTGGCCGAAGCCCGACATC
AACTTCGCCGAGGCCTTCATCGCCATCGCCAACATCGTCTTCGCTTACAGCTTCTGCATGTGCCAATTCTCCTTC
ATGGACGAGATGCACACCCCCGGCGACTACCTCAAGTCCATCTGGACGCTGGGAATCATCGAGATCATCATCTAC
ACCGTCACCGGCGCCGTCATATATGCCTTTGTCGGTATCGACGTCAAGTCGCCCGCCCTGCTGTCGGCCGGCCCG
CTCATCTCCAAGATCGCCTTTGGAGTCGCGCTGCCCGTCATCTTCATCTCGGGATCCATCAATACCACCGTCGTC
GGCCGCTATATCCACGGCCGCATCTTTCGAGACTCCGTCACGCGCTTCATCAACACGCCCAGGGGCTGGATCACC
TGGCTGGCCGTCATCACCGTCATCACCATCGCCGCCTTTGTCATCGCCGAGGTCATCCCCTTCTTTTCTGACCTG
CTGTCCATCTCGTCCTCTCTCTTCGTCTCCGGCTTCACCTTTTATATCCCTGCCATGATGTGGTACAAGTTGCTC
CGGGTAGGGCCGTGGTATTCGCGCGAAAACCTGATTCACGCCTTGATGAACGGCTTCTGCTTCATCATCGGCATC
GTCGTCCTGGTCTGCGGCACATATGGCAGTATCGACGATATCATTCACCAATTCAGTGAAGGAAAGGTCCGCGGC
GTCTTTGCTTGCGCACCCATCGCGTAA
Gene >Ophcf2|01602
ATGGGCATAATGGAGTACTCGTCGGAGCCCGACGCGAAGCTGGCCAAGTCGAGCTCCGAGCCTCGAGAGGAGACG
TCGTCCTCCTCGTCGGACAATGTACTGGGAGGCAGCGCCATCGCCGGCGAGGTCAGCGAGTTCGAGGAGCGGCGC
ATCGACGTGGAGAAGCAAAAGACGGAGGCGGGCGACGCTCACTTCCATCGGCTGGGCTGGAAGCGACTGACCGTC
ATCCTCATCGTCGAGGCCGTTGCTCTCGGAAGCTTGAGTCTCCCCGCGGCCTTTGCCACGCTTGGAATGGTGGCT
GGCGTCGTTTGCTGCGTCGGACTGGGTCTCATCGCCATCTATACCAGCGACATCGTCGGTCAGGTCAAGCTCAAG
TATCCCGAAGTCGCTCACTATGCCGACGCCGGACGGTTGCTCATGGGTCGTTTCGGCTACGAGCTCGTGGGCGCC
ATGTTCGTCTTGCAGTTGACCTTTCTCGTCGGCTCTCACACGCTGACGGGAACCATCGCCTTCCTCGACATCACC
AACAACGGCGCCTGCTCCGTCGTCTTCGGCTTCGTCTCGGCCGTCATCTTGTTGTTGCTGGCGATCCCCCCTTCG
TTCGCAGAGGTCGCCATCCTGGGATACATCGACTTCGTTTCCATCCTCGCCGCCATCGGCATCACGCTCATCGCC
ACCGGAATCATCGCCACCGACTCCCCCGGCGGTTTAGCCGCTGTGAACTGGTCCGCGTGGCCGAAGCCCGACATC
AACTTCGCCGAGGCCTTCATCGCCATCGCCAACATCGTCTTCGCTTACAGCTTCTGCATGTGCCAATTCTCCTTC
ATGGACGAGATGCACACCCCCGGCGACTACCTCAAGTCCATCTGGACGCTGGGAATCATCGAGATCATCATCTAC
ACCGTCACCGGCGCCGTCATATATGCCTTTGTCGGTATCGACGTCAAGTCGCCCGCCCTGCTGTCGGCCGGCCCG
CTCATCTCCAAGATCGCCTTTGGAGTCGCGCTGCCCGTCATCTTCATCTCGGGATCCATCAATACCACCGTCGTC
GGCCGCTATATCCACGGCCGCATCTTTCGAGACTCCGTCACGCGCTTCATCAACACGCCCAGGGGCTGGATCACC
TGGCTGGCCGTCATCACCGTCATCACCATCGCCGCCTTTGTCATCGCCGAGGTCATCCCCTTCTTTTCTGACCTG
CTGTCCATCTCGTCCTCTCTCTTCGTCTCCGGCTTCACCTTTTATATCCCTGCCATGATGTGGTACAAGTTGCTC
CGGGTAGGGCCGTGGTATTCGCGCGAAAACCTGATTCACGCCTTGATGAACGGCTTCTGCTTCATCATCGGCATC
GTCGTCCTGGTCTGCGGCACATATGGCAGTATCGACGATATCGTAAGTTTTGTTCAGATCTCGTCCCTCCGGGAC
AACCCGCTGGACGAGTCCTCCACTGCAGATTCACCAATTCAGTGAAGGAAAGGTCCGCGGCGTCTTTGCTTGCGC
ACCCATCGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail