Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01600
Gene name
Locationscaffold_01:5458638..5458953
Strand-
Gene length (bp)315
Transcript length (bp)315
Coding sequence length (bp)315
Protein length (aa) 105

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08772 NOB1_Zn_bind Nin one binding (NOB1) Zn-ribbon like 2.4E-33 13 84

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4973 0.4322 0.1233 0.1741 0.4318 0.0322 0.157 0.1151 0.06 0.014

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1005
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3860
Ophiocordyceps australis map64 (Brazil) OphauB2|3217
Ophiocordyceps camponoti-floridani Ophcf2|01600 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01601
Ophiocordyceps camponoti-rufipedis Ophun1|773
Ophiocordyceps kimflemingae Ophio5|7868
Ophiocordyceps subramaniannii Hirsu2|8667

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01600
MNLNLVHPSLARITQLKSWILRCHGCFATTKQMDRQFCPSCGQPTLLRASCSTDQHGVFTIHLKKNFQWNKRGNV
YSVPKPVHGTAGARVRRGRAAGRTGGAVG*
Coding >Ophcf2|01600
ATGAACCTCAACCTCGTCCACCCCTCCCTCGCCCGCATCACCCAGCTGAAAAGCTGGATCCTCCGCTGCCACGGC
TGCTTCGCAACCACCAAGCAGATGGACCGCCAATTCTGCCCCTCGTGCGGACAGCCCACCCTCCTGCGCGCCAGC
TGCTCCACCGACCAACACGGCGTCTTCACCATCCACCTCAAGAAGAACTTCCAATGGAACAAGCGCGGCAACGTC
TACAGCGTCCCCAAGCCCGTCCACGGCACCGCGGGGGCGCGGGTCCGTCGGGGACGGGCGGCGGGAAGAACGGGT
GGGGCCGTCGGCTGA
Transcript >Ophcf2|01600
ATGAACCTCAACCTCGTCCACCCCTCCCTCGCCCGCATCACCCAGCTGAAAAGCTGGATCCTCCGCTGCCACGGC
TGCTTCGCAACCACCAAGCAGATGGACCGCCAATTCTGCCCCTCGTGCGGACAGCCCACCCTCCTGCGCGCCAGC
TGCTCCACCGACCAACACGGCGTCTTCACCATCCACCTCAAGAAGAACTTCCAATGGAACAAGCGCGGCAACGTC
TACAGCGTCCCCAAGCCCGTCCACGGCACCGCGGGGGCGCGGGTCCGTCGGGGACGGGCGGCGGGAAGAACGGGT
GGGGCCGTCGGCTGA
Gene >Ophcf2|01600
ATGAACCTCAACCTCGTCCACCCCTCCCTCGCCCGCATCACCCAGCTGAAAAGCTGGATCCTCCGCTGCCACGGC
TGCTTCGCAACCACCAAGCAGATGGACCGCCAATTCTGCCCCTCGTGCGGACAGCCCACCCTCCTGCGCGCCAGC
TGCTCCACCGACCAACACGGCGTCTTCACCATCCACCTCAAGAAGAACTTCCAATGGAACAAGCGCGGCAACGTC
TACAGCGTCCCCAAGCCCGTCCACGGCACCGCGGGGGCGCGGGTCCGTCGGGGACGGGCGGCGGGAAGAACGGGT
GGGGCCGTCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail