Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01596
Gene name
Locationscaffold_01:5447879..5450520
Strand+
Gene length (bp)2641
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Peroxisomal targeting signal 0.3065 0.1984 0.3042 0.2044 0.3556 0.3098 0.7312 0.2222 0.4443 0.4187

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup296
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00022
Ophiocordyceps camponoti-floridani Ophcf2|01596 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06712
Ophiocordyceps camponoti-rufipedis Ophun1|1283
Ophiocordyceps camponoti-rufipedis Ophun1|2810
Ophiocordyceps camponoti-rufipedis Ophun1|950
Ophiocordyceps kimflemingae Ophio5|2947
Ophiocordyceps kimflemingae Ophio5|4080
Ophiocordyceps kimflemingae Ophio5|6414
Ophiocordyceps subramaniannii Hirsu2|9518

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01596
MSAETVTEKGPSLDVQDEDVYPLHAFDNAKINHKLLSWVMRFNDVLDVKKLHDSLSRLLEIGDWRKLGGRLRLTE
SGRLELHVPKQFSAEHPAVSFSHVTDFSGMPIEEHPLASRFPKPTVEPSTQPVFGFRPFLAPSDYPKTLEEMIGR
DLPQISLHITSFSNATLVAVAWPHTLMDAVGQQDLLRSWSFVLAGREEDVPPLLGARDDILKELEDEESEENREP
LAIERHRLGKIGFLAMIARLLWERLWGPPLEMRAIYLPRKIFSRLQREAENQMDELPKDADQTNFISEGDILFAW
LAQTVGLSKPGPRPLTIVSFFNARYRLPRLRNELSGVYVQNMTQLSFTLVPSKLVKAPVGHLAVQHRRQLAEQSS
KQQTLSLLRTFRQKIETEQLKSTVYGQSNALPMFCNNLTKLHLLRAADFGPAVLSRGECSCKETRRLNPPGTMVM
YYNQPVEDDLGPLDSFYMLGKDYGDNYWLLGNFQAQTWTKLEQDLQRLKEPESVPLHAQLETAPRHSRPRSMLSW
FTLATIVQYQASGYRG*
Coding >Ophcf2|01596
ATGTCGGCGGAAACCGTGACCGAGAAGGGCCCGTCTCTGGACGTCCAAGACGAAGACGTCTATCCCCTGCACGCC
TTTGACAATGCCAAGATCAACCACAAGCTCCTGTCGTGGGTGATGCGGTTCAACGATGTCCTGGACGTCAAGAAG
CTACACGATTCCCTCTCGAGGCTTCTGGAGATTGGCGACTGGAGGAAGCTCGGCGGGAGGCTCAGGCTTACGGAG
TCTGGAAGGCTGGAGCTTCATGTTCCGAAGCAGTTTTCAGCAGAACATCCAGCTGTTTCCTTCAGTCACGTCACC
GACTTCTCCGGAATGCCCATCGAAGAGCATCCCCTAGCCAGTAGATTTCCCAAGCCGACCGTCGAGCCATCCACT
CAGCCAGTCTTTGGCTTCCGTCCCTTCCTCGCCCCCTCAGATTATCCCAAGACACTGGAGGAGATGATCGGCCGA
GATTTGCCTCAGATATCGTTACACATCACCTCGTTCAGCAACGCTACCCTCGTGGCCGTGGCCTGGCCTCACACC
CTCATGGACGCTGTAGGTCAGCAGGACTTGTTGCGCAGCTGGTCTTTTGTTCTGGCAGGGCGTGAGGAAGATGTT
CCTCCCCTCCTCGGAGCCCGGGATGACATCCTCAAGGAACTCGAGGACGAAGAGAGCGAGGAAAACAGGGAGCCG
CTTGCCATTGAACGGCATCGTTTGGGGAAAATAGGCTTCTTGGCCATGATTGCTCGTCTTCTATGGGAACGGCTC
TGGGGTCCCCCATTGGAAATGCGTGCTATATACCTCCCTCGAAAGATCTTTTCCCGACTTCAAAGAGAGGCAGAG
AATCAGATGGACGAGCTCCCCAAAGACGCCGACCAGACCAACTTCATAAGCGAGGGCGACATCCTCTTCGCTTGG
CTCGCTCAGACGGTAGGGCTATCCAAGCCCGGACCGCGGCCTCTCACCATCGTCAGCTTCTTCAACGCCCGCTAC
CGGCTCCCGCGGCTTCGGAACGAGCTCTCGGGCGTCTACGTTCAGAACATGACGCAGCTGAGCTTCACCCTCGTC
CCGTCCAAGCTCGTCAAGGCTCCCGTCGGTCATCTTGCCGTGCAGCATCGCCGGCAGCTGGCCGAGCAATCGTCC
AAGCAACAGACGCTGAGCCTGCTGCGGACTTTTCGGCAGAAGATCGAGACGGAACAGCTCAAGAGCACCGTTTAT
GGCCAGAGTAATGCCCTGCCCATGTTTTGCAATAATCTGACCAAGCTCCATCTTCTCAGGGCCGCTGACTTTGGC
CCGGCTGTCTTGTCCCGCGGCGAGTGCAGCTGCAAGGAGACGAGGAGGCTCAACCCGCCGGGAACCATGGTCATG
TACTATAACCAGCCCGTTGAAGACGACCTGGGACCGCTGGATTCGTTTTACATGCTTGGTAAGGACTACGGGGAT
AACTACTGGCTCCTGGGCAATTTTCAAGCACAGACGTGGACGAAGCTGGAGCAGGATTTGCAGAGACTGAAAGAG
CCCGAGTCGGTGCCGCTTCATGCCCAGCTTGAGACGGCGCCTCGCCATTCCCGACCTCGCTCCATGCTGTCATGG
TTCACGCTGGCCACTATCGTTCAATACCAAGCGTCTGGCTATCGCGGCTGA
Transcript >Ophcf2|01596
ATGTCGGCGGAAACCGTGACCGAGAAGGGCCCGTCTCTGGACGTCCAAGACGAAGACGTCTATCCCCTGCACGCC
TTTGACAATGCCAAGATCAACCACAAGCTCCTGTCGTGGGTGATGCGGTTCAACGATGTCCTGGACGTCAAGAAG
CTACACGATTCCCTCTCGAGGCTTCTGGAGATTGGCGACTGGAGGAAGCTCGGCGGGAGGCTCAGGCTTACGGAG
TCTGGAAGGCTGGAGCTTCATGTTCCGAAGCAGTTTTCAGCAGAACATCCAGCTGTTTCCTTCAGTCACGTCACC
GACTTCTCCGGAATGCCCATCGAAGAGCATCCCCTAGCCAGTAGATTTCCCAAGCCGACCGTCGAGCCATCCACT
CAGCCAGTCTTTGGCTTCCGTCCCTTCCTCGCCCCCTCAGATTATCCCAAGACACTGGAGGAGATGATCGGCCGA
GATTTGCCTCAGATATCGTTACACATCACCTCGTTCAGCAACGCTACCCTCGTGGCCGTGGCCTGGCCTCACACC
CTCATGGACGCTGTAGGTCAGCAGGACTTGTTGCGCAGCTGGTCTTTTGTTCTGGCAGGGCGTGAGGAAGATGTT
CCTCCCCTCCTCGGAGCCCGGGATGACATCCTCAAGGAACTCGAGGACGAAGAGAGCGAGGAAAACAGGGAGCCG
CTTGCCATTGAACGGCATCGTTTGGGGAAAATAGGCTTCTTGGCCATGATTGCTCGTCTTCTATGGGAACGGCTC
TGGGGTCCCCCATTGGAAATGCGTGCTATATACCTCCCTCGAAAGATCTTTTCCCGACTTCAAAGAGAGGCAGAG
AATCAGATGGACGAGCTCCCCAAAGACGCCGACCAGACCAACTTCATAAGCGAGGGCGACATCCTCTTCGCTTGG
CTCGCTCAGACGGTAGGGCTATCCAAGCCCGGACCGCGGCCTCTCACCATCGTCAGCTTCTTCAACGCCCGCTAC
CGGCTCCCGCGGCTTCGGAACGAGCTCTCGGGCGTCTACGTTCAGAACATGACGCAGCTGAGCTTCACCCTCGTC
CCGTCCAAGCTCGTCAAGGCTCCCGTCGGTCATCTTGCCGTGCAGCATCGCCGGCAGCTGGCCGAGCAATCGTCC
AAGCAACAGACGCTGAGCCTGCTGCGGACTTTTCGGCAGAAGATCGAGACGGAACAGCTCAAGAGCACCGTTTAT
GGCCAGAGTAATGCCCTGCCCATGTTTTGCAATAATCTGACCAAGCTCCATCTTCTCAGGGCCGCTGACTTTGGC
CCGGCTGTCTTGTCCCGCGGCGAGTGCAGCTGCAAGGAGACGAGGAGGCTCAACCCGCCGGGAACCATGGTCATG
TACTATAACCAGCCCGTTGAAGACGACCTGGGACCGCTGGATTCGTTTTACATGCTTGGTAAGGACTACGGGGAT
AACTACTGGCTCCTGGGCAATTTTCAAGCACAGACGTGGACGAAGCTGGAGCAGGATTTGCAGAGACTGAAAGAG
CCCGAGTCGGTGCCGCTTCATGCCCAGCTTGAGACGGCGCCTCGCCATTCCCGACCTCGCTCCATGCTGTCATGG
TTCACGCTGGCCACTATCGTTCAATACCAAGCGTCTGGCTATCGCGGCTGA
Gene >Ophcf2|01596
ATGTCGGCGGAAACCGTGACCGAGAAGGGCCCGTCTCTGGACGTCCAAGACGAAGACGTCTATCCCCTGCACGCC
TTTGACAATGCCAAGATCAACCACAAGCTCCTGTCGTGGGTGATGCGGTTCAACGATGTCCTGGACGTCAAGAAG
CTACACGATTCCCTCTCGAGGCTTCTGGAGATTGGCGACTGGAGGAAGCTCGGCGGGAGGCTCAGGCTTACGGTA
TGTACTGGGTCGAAGGTGTTTGATTGTGGCAACAGCTGTTCTCTGACAGCGCTCATGAAGGAGTCTGGAAGGCTG
GAGCTTCATGTTCCGAAGCAGTTTTCAGCAGAACATCCAGCTGTTTCCTTCAGTCACGTCACCGACTTCTCCGGA
ATGCCCATCGAAGAGCATCCCCTAGCCAGTAGATTTCCCAAGCCGACCGTCGAGCCATCCACTCAGCCAGTCTTT
GGCTTCCGTCCCTTCCTCGCCCCCTCAGATTATCCCAAGACACTGGAGGAGATGATCGGCCGAGATTTGCCTCAG
ATATCGTTACACATCACCTCGTTCAGCAACGCTACCCTCGTGGCCGTGGCCTGGCCTCACACCCTCATGGACGCT
GTAGGTCAGCAGGACTTGTTGCGCAGCTGGTCTTTTGTTCTGGCAGGGCGTGAGGAAGATGTTCCTCCCCTCCTC
GGAGCCCGGGATGACATCCTCAAGGAACTCGAGGACGAAGAGAGCGAGGAAAACAGGGAGCCGCTTGCCATTGAA
CGGCATCGTTTGGGGAAAATAGGCTTCTTGGCCATGATTGCTCGTCTTCTATGGGAACGGCTCTGGGGTCCCCCA
TTGGAAATGCGTGCTATATACCTCCCTCGAAAGATCTTTTCCCGACTTCAAAGAGAGGCAGAGAATCAGATGGAC
GAGCTCCCCAAAGACGCCGACCAGACCAACTTCATAAGCGAGGGCGACATCCTCTTCGCTTGGCTCGCTCAGACG
GTAGGGCTATCCAAGCCCGGACCGCGGCCTCTCACCATCGTCAGCTTCTTCAACGCCCGCTACCGGCTCCCGCGG
CTTCGGAACGAGCTCTCGGGCGTCTACGTTCAGAACATGACGCAGCTGAGCTTCACCCTCGTCCCGTCCAAGCTC
GTCAAGGCTCCCGTCGGTCATCTTGCCGTGCAGCATCGCCGGCAGCTGGCCGAGCAATCGTCCAAGCAACAGACG
CTGAGCCTGCTGCGGACTTTTCGGCAGAAGATCGAGACGGAACAGCTCAAGAGCACCGTTTATGGCCAGAGTAAT
GCCCTGCCCATGTTTTGCAATAATCTGACCAAGCTCCATCTTCTCAGGGCCGCTGACTTTGGCCCGGCTGTCTTG
TCCCGCGGCGAGTGCAGCTGCAAGGAGACGAGGAGGCTCAACCCGCCGGGAACCATGGTCATGTACTATAACCAG
CCCGTTGAAGACGACCTGGGACCGCTGGATTCGTTTTACATGCTTGGTAAGGACTACGGGGATAACTACTGGCTC
CTGGGCAATTTTCAAGCACAGACGTGGACGAAGCTGGAGCAGGATTTGCAGAGACTGAAAGAGCCCGAGTCGGTG
CCGCTTCATGCCCAGCTTGAGACGGCGCCTGTTGGATATATGGGAGGAGGATCAGGAGAAAGGGCAGTACATGTA
GTGGGAGAGGAGTAGAAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGCAGAGGAGGATGAGCTGGAGGGGAAA
GAGAGGTAGAGGAGCTGGAGGAGGACAAGGGGAAAGACGAGGGGAAAAAGAAAACAATGAGAGGGAAGCTGTTCG
ATAACAAACCTTCCGGCTCGGCTGACGCGAATCGGCTTGGCAGCAAGAAACCAATACATGATTGATCCAAGCCAC
CGGCTTCCATGCGGTATTTACCAGCTAACAGCGTGCCGATCCGACGCGGACTCCCCTATCTCCCATCTCTGACCC
GTTGGTCTGACGGTGACAGCCGCAAAGACCTCTGCTGTCGGAGCTCGCGACCGTGGTTCGAGGGTAGACTAAGCA
GTTACAATGACATGGCATCGGCGCCTCCACCTGGCATCATCAGGGCCGGAACGAGAGACGGATAGGGCGAGGAAG
CCGGCTTCATCCGTTAGTGTCGCCCCCCTTTTTCCCTCGCTGTGCTAGGACACACGCCAGAGGAATTACCAATAC
ACTTCTTACACCGCTCACCGGCCCTCTAGCATGCGTCTGTGTACGTTTGCTTGTAGAGGTAGAGTCCCAGCAAGT
CCCCCCTTTACACGTGTCTCCCATGGCGGCTCTTGGCGTGACGCGCAACGAAGAAGTTGATGATGTATGTTTAAA
TGTGACTGTAGCACACAGCCACAAACCCCAAGCACTACACGTTTCGTCCCATGAGCTGCGTGTCGGATGGAGATG
GCGGCTTGATCGGCCAGCCGTGTCTCACTAGCCTTATCCTTTGATGCTGGCCCGGTTTCGCGAAAAAAAACAGGC
TTCTTATTGGCGACGCGTGCCGTAGCCTGAGATTTACAATGTGGTTGACATTCTAGATCAGCGAGCTTAACTTAA
GCTTAAGCGCCATTCCCGACCTCGCTCCATGCTGTCATGGTTCACGCTGGCCACTATCGTTCAATACCAAGCGTC
TGGCTATCGCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail