Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01588
Gene name
Locationscaffold_01:5414377..5415176
Strand-
Gene length (bp)799
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit 4.9E-15 70 187

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 99 121 22
2 136 158 22
3 179 196 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01588
MSRAERVIGCGGLGSERSVCPLDEVGTVNVSHPSKSNANPPPPLPLNHANQPPNHKAHPQESHQILTAQRLNRPV
APHLSIYEPSQTWFGASAWTRITGCSLSGAAYVYLTGYLVAPLLGLHLGSAELAAGFAAWPFFAKGVVKFALAFP
FTFHFFVGVKHLVYDLGVGFAKGTIRRGEMALWVASLAGGLFLAFGV*
Coding >Ophcf2|01588
ATGTCACGTGCGGAGCGGGTGATTGGCTGCGGGGGCCTCGGCTCTGAACGGTCCGTCTGTCCCTTGGATGAGGTC
GGGACTGTCAACGTCAGTCACCCTTCAAAGAGCAACGCCAACCCTCCTCCGCCACTCCCTCTCAACCACGCAAAC
CAACCCCCCAACCACAAAGCTCACCCCCAAGAATCACACCAAATCCTCACCGCCCAGCGCCTAAACCGCCCCGTC
GCCCCCCACCTATCCATCTACGAGCCCTCGCAGACCTGGTTCGGAGCCTCGGCCTGGACCCGCATAACCGGCTGC
TCCCTCTCCGGCGCGGCCTACGTCTACCTGACGGGCTACCTCGTCGCCCCGCTGCTGGGTCTTCACCTGGGCAGC
GCCGAACTCGCGGCTGGTTTCGCGGCGTGGCCCTTTTTCGCAAAGGGCGTGGTGAAATTCGCCCTGGCGTTTCCC
TTTACCTTTCATTTCTTCGTGGGGGTGAAGCATCTGGTTTATGATTTGGGGGTTGGCTTCGCCAAGGGGACTATT
CGGAGGGGGGAGATGGCGCTTTGGGTTGCTAGTCTTGCTGGGGGGTTGTTTCTCGCGTTTGGGGTATGA
Transcript >Ophcf2|01588
ATGTCACGTGCGGAGCGGGTGATTGGCTGCGGGGGCCTCGGCTCTGAACGGTCCGTCTGTCCCTTGGATGAGGTC
GGGACTGTCAACGTCAGTCACCCTTCAAAGAGCAACGCCAACCCTCCTCCGCCACTCCCTCTCAACCACGCAAAC
CAACCCCCCAACCACAAAGCTCACCCCCAAGAATCACACCAAATCCTCACCGCCCAGCGCCTAAACCGCCCCGTC
GCCCCCCACCTATCCATCTACGAGCCCTCGCAGACCTGGTTCGGAGCCTCGGCCTGGACCCGCATAACCGGCTGC
TCCCTCTCCGGCGCGGCCTACGTCTACCTGACGGGCTACCTCGTCGCCCCGCTGCTGGGTCTTCACCTGGGCAGC
GCCGAACTCGCGGCTGGTTTCGCGGCGTGGCCCTTTTTCGCAAAGGGCGTGGTGAAATTCGCCCTGGCGTTTCCC
TTTACCTTTCATTTCTTCGTGGGGGTGAAGCATCTGGTTTATGATTTGGGGGTTGGCTTCGCCAAGGGGACTATT
CGGAGGGGGGAGATGGCGCTTTGGGTTGCTAGTCTTGCTGGGGGGTTGTTTCTCGCGTTTGGGGTATGA
Gene >Ophcf2|01588
ATGTCACGTGCGGAGCGGGTGATTGGCTGCGGGGGCCTCGGCTCTGAACGGTCCGTCTGTCCCTTGGATGAGGTC
GGGACTGTCAACGTCAGTCAGTCAGTCAGTCAGACAGATCATCAACCTCTTCGACGTCAAACCACCATGATCTCC
CAACGAATCTCCCCAAGAGCATCCCTCACAGCCCTTCAAAGAGGTCCGTCACCACCCTCAACCTCACACCACCCC
AAGCTAACCACCCCAACCCCCCCCCAGCAACGCCAACCCTCCTCCGCCACTCCCTCTCAACCACGCAAACCAAGT
CTGTACTCCCCCCCCCCCCGGGGACATCCCATCTACCTCCATCTAACCAGCAAGCTAGCCCCCCAACCACAAAGC
TCACCCCCAAGAATCACACCAAATCCTCACCGCCCAGCGCCTAAACCGCCCCGTCGCCCCCCACCTATCCATCTA
CGAGCCCTCGCAGACCTGGTTCGGAGCCTCGGCCTGGACCCGCATAACCGGCTGCTCCCTCTCCGGCGCGGCCTA
CGTCTACCTGACGGGCTACCTCGTCGCCCCGCTGCTGGGTCTTCACCTGGGCAGCGCCGAACTCGCGGCTGGTTT
CGCGGCGTGGCCCTTTTTCGCAAAGGGCGTGGTGAAATTCGCCCTGGCGTTTCCCTTTACCTTTCATTTCTTCGT
GGGGGTGAAGCATCTGGTTTATGATTTGGGGGTTGGCTTCGCCAAGGGGACTATTCGGAGGGGGGAGATGGCGCT
TTGGGTTGCTAGTCTTGCTGGGGGGTTGTTTCTCGCGTTTGGGGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail