Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01584
Gene name
Locationscaffold_01:5405539..5408996
Strand+
Gene length (bp)3457
Transcript length (bp)2847
Coding sequence length (bp)2847
Protein length (aa) 949

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 8.2E-48 204 383
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 3.6E-15 401 673
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 1.6E-08 90 143

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 126 148 22
2 168 187 19
3 316 338 22
4 358 380 22
5 718 740 22
6 746 765 19
7 786 808 22
8 852 874 22
9 883 905 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 311.38 133.47 489.29
Alive In ants, during behavior modification 165.90 70.04 261.76
Dead In ants, recently dead 203.93 93.26 314.61

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.008044 yes
Alive Dead 0.355343 no
Dead Fungus 0.076964 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01584
MADEGPTGAPALDTSIESGRFDEKRAQAQPAPELPHTKPPAPAAEDEEEDEDIDALIEDLESQDGHGGFEEEEEE
QGGPGVGRVVPEDMLQTDSHLGLTESEVSSRRRKYGLNQMKEEKENMILKFFSYFVGPIQFVMEILCCLASADWL
LHTSFWAAAVLAAGLQDWVDFGVICALLLLNACVGFVQEFQAGSIVEELKKTLALKAVVLRDGTLKEIEAPEVVP
GDILQVEEGTIIPADGRIVTEDAFLQVDQSAITGESLAVDKHKNDSCFASSAVKRGEAFLVVTATGDNTFVGRAA
ALVSQSAGGTGHFTEVLNGIGTVLLILVVVTLLVVWTSSFYRSNPIVKILRFTLAITIVGVPVGLPAVVTTTMAV
GAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLSEPFTVPGVDPDDLMLTACLAASRKKKGIDAID
KAFLKALKYYPRAKSVLSKYKVLDFHPFDPVSKKVQAVVESPQGERIICVKGAPLFVLKTVEEDHPIPESIDKAY
KNCVAEFATRGFRSLGVARKRGEGAWEILGIMPCSDPPRHDTARTINEAKLLGLSIKMLTGDAVGIARETSRQLG
LGTNVYNAERLGLGGGGDMPGSEVYDFVEAADGFAEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTG
IAVEGASDAARSAADIVFLAPGLGAIIDALKTSRQIFHRMYAYVVYRIALSLHMEIFLGLWIAILNRSLNIELIV
FIAIFADIATLAIAYDNAPFSQTPVKWNLPKLWGMSVLLGVVLAIGTWITLTTMYAGGEGRGIIQNFGNMDEVLF
LEISLTENWLIFITRANGPFWSSIPSWQLSGAIFLVDIIATLFCIFGWFEHGHQTSIVAVVRIWIFSFGIFAVMG
GLYYFMQGSAGFDSLMHGKSPKRNQKQRSLEDFVVSLQRVSTQHEKSQ*
Coding >Ophcf2|01584
ATGGCCGACGAGGGCCCTACCGGCGCGCCCGCGCTCGACACCAGCATCGAGTCGGGTCGCTTCGACGAGAAGAGA
GCTCAAGCCCAGCCGGCTCCCGAATTACCGCATACCAAGCCCCCGGCTCCCGCCGCCGAAGACGAGGAAGAGGAT
GAGGACATTGACGCCCTGATTGAGGATCTCGAATCCCAAGATGGCCATGGCGGCTTCGAAGAGGAGGAAGAGGAA
CAGGGTGGTCCAGGCGTCGGCCGTGTCGTTCCCGAGGACATGCTTCAGACGGACAGCCACCTTGGTCTCACCGAG
TCCGAGGTCAGCTCGCGCCGTCGCAAGTACGGTCTCAACCAGATGAAGGAAGAGAAGGAGAACATGATTCTCAAG
TTCTTTTCCTACTTTGTCGGGCCCATCCAGTTCGTCATGGAGATTTTGTGTTGCCTGGCTTCCGCAGATTGGCTG
CTCCACACGAGCTTTTGGGCTGCCGCCGTCTTGGCTGCCGGTCTGCAAGATTGGGTCGACTTTGGTGTCATCTGT
GCCCTGCTATTGCTCAACGCCTGTGTCGGTTTCGTCCAGGAATTCCAGGCTGGCTCCATCGTCGAGGAGCTCAAG
AAGACGCTGGCCCTAAAGGCCGTCGTTCTGCGCGACGGTACTCTCAAGGAAATCGAGGCCCCAGAGGTCGTACCC
GGCGATATCCTGCAGGTCGAAGAGGGCACCATCATCCCCGCCGACGGACGCATCGTGACCGAAGATGCCTTCCTC
CAGGTCGATCAGTCGGCCATCACGGGCGAGTCGCTCGCCGTCGACAAGCACAAGAATGACAGCTGTTTCGCTTCC
TCGGCCGTCAAGCGTGGCGAGGCCTTCTTGGTGGTCACCGCCACCGGCGACAACACCTTCGTCGGCCGCGCTGCC
GCCCTCGTCTCCCAGTCCGCCGGCGGCACCGGTCACTTCACAGAGGTGCTCAACGGCATCGGCACCGTCCTGCTG
ATCCTCGTCGTCGTCACCCTGCTCGTCGTCTGGACCTCGTCCTTCTATCGCTCCAATCCCATCGTCAAGATCCTG
CGCTTCACCCTGGCCATCACCATCGTCGGCGTCCCCGTCGGTCTACCCGCTGTCGTCACCACCACCATGGCCGTC
GGCGCCGCCTACCTCGCCAAGAAGCAGGCCATTGTCCAGAAGCTGTCGGCCATCGAGTCCCTGGCTGGTGTCGAG
ATCCTCTGCTCCGACAAGACGGGCACCCTGACAAAGAACAAGCTGTCGCTTTCGGAGCCCTTTACCGTTCCCGGC
GTCGACCCCGACGACCTGATGCTGACGGCCTGCTTGGCTGCCTCGCGCAAGAAGAAGGGTATCGACGCCATCGAC
AAGGCCTTCCTCAAGGCGCTCAAGTACTACCCCCGCGCCAAGAGTGTCCTGTCCAAGTACAAGGTGCTCGATTTC
CATCCCTTCGATCCCGTCTCGAAAAAGGTGCAGGCCGTCGTCGAGTCGCCTCAGGGCGAGCGCATCATCTGCGTC
AAGGGAGCGCCGCTCTTCGTCCTCAAGACCGTCGAGGAGGACCACCCGATCCCCGAGTCCATCGACAAGGCCTAC
AAGAACTGCGTCGCCGAGTTCGCCACCCGCGGCTTCCGTTCGCTCGGTGTCGCCCGCAAGCGCGGCGAGGGTGCC
TGGGAGATTCTCGGCATCATGCCCTGCTCCGATCCTCCTCGTCACGACACGGCCAGGACCATCAACGAGGCCAAG
CTGCTGGGTCTGTCCATCAAGATGTTGACGGGTGACGCCGTCGGCATCGCCCGTGAGACGTCTCGTCAGCTCGGC
CTCGGCACCAACGTCTACAACGCCGAGCGGCTCGGTCTCGGCGGCGGCGGCGACATGCCCGGCTCCGAGGTGTAC
GATTTCGTCGAGGCCGCCGACGGTTTCGCCGAGGTGTTCCCCCAGCACAAGTACTCGGTCGTCGAGATCCTGCAG
CAGCGTGGCTACCTCGTCGCCATGACCGGAGACGGTGTCAACGACGCGCCCTCGCTGAAGAAGGCAGACACGGGC
ATCGCCGTCGAGGGGGCCTCCGACGCCGCCCGATCCGCCGCCGACATCGTCTTTCTCGCGCCCGGCCTCGGGGCC
ATTATCGATGCCCTCAAGACGTCGCGCCAGATCTTCCACCGCATGTACGCCTACGTCGTCTACCGTATTGCCCTG
TCCCTTCACATGGAGATCTTCCTCGGCCTCTGGATCGCCATCCTGAACCGCAGTCTCAACATTGAGCTCATCGTC
TTCATCGCCATCTTCGCCGACATCGCCACGCTGGCCATTGCCTACGACAACGCCCCCTTCTCGCAGACGCCCGTC
AAGTGGAACCTCCCCAAGCTCTGGGGCATGTCGGTCCTGCTGGGCGTCGTCCTGGCCATTGGCACCTGGATCACG
CTGACGACCATGTACGCCGGCGGCGAGGGACGCGGTATCATCCAGAACTTTGGCAACATGGACGAGGTGCTTTTC
CTCGAAATCTCGCTGACGGAGAACTGGCTCATCTTCATCACGCGTGCCAACGGGCCATTTTGGTCGTCGATTCCG
TCGTGGCAGCTCAGCGGCGCCATCTTCCTCGTCGACATCATCGCCACCCTGTTCTGCATCTTCGGCTGGTTCGAA
CATGGGCACCAGACGAGCATCGTGGCCGTGGTCCGGATCTGGATCTTCTCCTTCGGCATCTTCGCCGTCATGGGC
GGCCTGTACTACTTCATGCAGGGCTCCGCGGGCTTCGACAGCCTGATGCACGGCAAGTCCCCGAAGCGGAACCAG
AAGCAGCGATCACTGGAAGACTTTGTCGTCTCCCTGCAGCGTGTCTCGACTCAGCACGAGAAGTCTCAGTAA
Transcript >Ophcf2|01584
ATGGCCGACGAGGGCCCTACCGGCGCGCCCGCGCTCGACACCAGCATCGAGTCGGGTCGCTTCGACGAGAAGAGA
GCTCAAGCCCAGCCGGCTCCCGAATTACCGCATACCAAGCCCCCGGCTCCCGCCGCCGAAGACGAGGAAGAGGAT
GAGGACATTGACGCCCTGATTGAGGATCTCGAATCCCAAGATGGCCATGGCGGCTTCGAAGAGGAGGAAGAGGAA
CAGGGTGGTCCAGGCGTCGGCCGTGTCGTTCCCGAGGACATGCTTCAGACGGACAGCCACCTTGGTCTCACCGAG
TCCGAGGTCAGCTCGCGCCGTCGCAAGTACGGTCTCAACCAGATGAAGGAAGAGAAGGAGAACATGATTCTCAAG
TTCTTTTCCTACTTTGTCGGGCCCATCCAGTTCGTCATGGAGATTTTGTGTTGCCTGGCTTCCGCAGATTGGCTG
CTCCACACGAGCTTTTGGGCTGCCGCCGTCTTGGCTGCCGGTCTGCAAGATTGGGTCGACTTTGGTGTCATCTGT
GCCCTGCTATTGCTCAACGCCTGTGTCGGTTTCGTCCAGGAATTCCAGGCTGGCTCCATCGTCGAGGAGCTCAAG
AAGACGCTGGCCCTAAAGGCCGTCGTTCTGCGCGACGGTACTCTCAAGGAAATCGAGGCCCCAGAGGTCGTACCC
GGCGATATCCTGCAGGTCGAAGAGGGCACCATCATCCCCGCCGACGGACGCATCGTGACCGAAGATGCCTTCCTC
CAGGTCGATCAGTCGGCCATCACGGGCGAGTCGCTCGCCGTCGACAAGCACAAGAATGACAGCTGTTTCGCTTCC
TCGGCCGTCAAGCGTGGCGAGGCCTTCTTGGTGGTCACCGCCACCGGCGACAACACCTTCGTCGGCCGCGCTGCC
GCCCTCGTCTCCCAGTCCGCCGGCGGCACCGGTCACTTCACAGAGGTGCTCAACGGCATCGGCACCGTCCTGCTG
ATCCTCGTCGTCGTCACCCTGCTCGTCGTCTGGACCTCGTCCTTCTATCGCTCCAATCCCATCGTCAAGATCCTG
CGCTTCACCCTGGCCATCACCATCGTCGGCGTCCCCGTCGGTCTACCCGCTGTCGTCACCACCACCATGGCCGTC
GGCGCCGCCTACCTCGCCAAGAAGCAGGCCATTGTCCAGAAGCTGTCGGCCATCGAGTCCCTGGCTGGTGTCGAG
ATCCTCTGCTCCGACAAGACGGGCACCCTGACAAAGAACAAGCTGTCGCTTTCGGAGCCCTTTACCGTTCCCGGC
GTCGACCCCGACGACCTGATGCTGACGGCCTGCTTGGCTGCCTCGCGCAAGAAGAAGGGTATCGACGCCATCGAC
AAGGCCTTCCTCAAGGCGCTCAAGTACTACCCCCGCGCCAAGAGTGTCCTGTCCAAGTACAAGGTGCTCGATTTC
CATCCCTTCGATCCCGTCTCGAAAAAGGTGCAGGCCGTCGTCGAGTCGCCTCAGGGCGAGCGCATCATCTGCGTC
AAGGGAGCGCCGCTCTTCGTCCTCAAGACCGTCGAGGAGGACCACCCGATCCCCGAGTCCATCGACAAGGCCTAC
AAGAACTGCGTCGCCGAGTTCGCCACCCGCGGCTTCCGTTCGCTCGGTGTCGCCCGCAAGCGCGGCGAGGGTGCC
TGGGAGATTCTCGGCATCATGCCCTGCTCCGATCCTCCTCGTCACGACACGGCCAGGACCATCAACGAGGCCAAG
CTGCTGGGTCTGTCCATCAAGATGTTGACGGGTGACGCCGTCGGCATCGCCCGTGAGACGTCTCGTCAGCTCGGC
CTCGGCACCAACGTCTACAACGCCGAGCGGCTCGGTCTCGGCGGCGGCGGCGACATGCCCGGCTCCGAGGTGTAC
GATTTCGTCGAGGCCGCCGACGGTTTCGCCGAGGTGTTCCCCCAGCACAAGTACTCGGTCGTCGAGATCCTGCAG
CAGCGTGGCTACCTCGTCGCCATGACCGGAGACGGTGTCAACGACGCGCCCTCGCTGAAGAAGGCAGACACGGGC
ATCGCCGTCGAGGGGGCCTCCGACGCCGCCCGATCCGCCGCCGACATCGTCTTTCTCGCGCCCGGCCTCGGGGCC
ATTATCGATGCCCTCAAGACGTCGCGCCAGATCTTCCACCGCATGTACGCCTACGTCGTCTACCGTATTGCCCTG
TCCCTTCACATGGAGATCTTCCTCGGCCTCTGGATCGCCATCCTGAACCGCAGTCTCAACATTGAGCTCATCGTC
TTCATCGCCATCTTCGCCGACATCGCCACGCTGGCCATTGCCTACGACAACGCCCCCTTCTCGCAGACGCCCGTC
AAGTGGAACCTCCCCAAGCTCTGGGGCATGTCGGTCCTGCTGGGCGTCGTCCTGGCCATTGGCACCTGGATCACG
CTGACGACCATGTACGCCGGCGGCGAGGGACGCGGTATCATCCAGAACTTTGGCAACATGGACGAGGTGCTTTTC
CTCGAAATCTCGCTGACGGAGAACTGGCTCATCTTCATCACGCGTGCCAACGGGCCATTTTGGTCGTCGATTCCG
TCGTGGCAGCTCAGCGGCGCCATCTTCCTCGTCGACATCATCGCCACCCTGTTCTGCATCTTCGGCTGGTTCGAA
CATGGGCACCAGACGAGCATCGTGGCCGTGGTCCGGATCTGGATCTTCTCCTTCGGCATCTTCGCCGTCATGGGC
GGCCTGTACTACTTCATGCAGGGCTCCGCGGGCTTCGACAGCCTGATGCACGGCAAGTCCCCGAAGCGGAACCAG
AAGCAGCGATCACTGGAAGACTTTGTCGTCTCCCTGCAGCGTGTCTCGACTCAGCACGAGAAGTCTCAGTAA
Gene >Ophcf2|01584
ATGGCCGACGAGGGCCCTACCGGCGCGCCCGCGCTCGACACCAGCATCGAGTCGGGTCGCTTCGACGAGAAGAGA
GCTCAAGCCCAGCCGGCTCCCGAATTACCGCATACCAAGCCCCCGGCTCCCGCCGCCGAAGACGAGGAAGAGGAT
GAGGACATTGACGCCCTGATTGAGGATCTCGAATCCCAAGATGGCCATGGCGGCTTCGAAGAGGAGGAAGAGGAA
CAGGGTGGTCCAGGCGTCGGCCGTGTCGTTCCCGAGGACATGCTTCAGACGGACAGCCACCTTGGTCTCACCGAG
TCCGAGGTCAGCTCGCGCCGTCGCAAGTACGGTCTCAACCAGATGAAGGAAGAGAAGGAGAACATGATTCTCAAG
TTCTTTTCCTACTTTGTCGGGCCCATCCAGTTCGTCATGGAGGTGAGTTTTTTTTTTTCTTTCTTTCTTTTTGTC
CTTTTTCCATGCCGTCTTCTCCTCTCTTCTACGTGTTGTTTTTTTTTGCTTTTGGCCTTGTCCTCCTCCGATGTC
GACCTTTGGAATGCGACTGCGAATTCCCGACCAGCCACCTTCAGCTGGTCTTGTTTTCCCTGGATCGGAGCCTCT
TCGGCCGCTCTCACTGTTTTTTTTTTTAAACCCCGTCCCTCTTTTTATTCTCTTTTAGATTTTGTGTTGCCTGGC
TTCCGCAGATTGGCTGCTCCACACGAGCTTTTGGGTGGGCCGTCATCAATTGGGCCCTAGCAGTCAATGCTCAGT
GGAGAGGGGAAACGATGCTCACCCGCTACGACGCCACCCCACTGTTCTGTTTGTTGCGAAACAAAGTTCCTCGTG
CTGATCAAGCCCTTTGTTTTTTTTTTTTTCCCTTTTTTTTTCCCCTTCTGCTTGTCATTGGCACGCGACGCTAAC
CCCTGCTTTTCCAATCAGGCTGCCGCCGTCTTGGCTGCCGGTCTGCAAGATTGGGTCGACTTTGGTGTCATCTGT
GCCCTGCTATTGCTCAACGCCTGTGTCGGTTTCGTCCAGGAATTCCAGGCTGGCTCCATCGTCGAGGAGCTCAAG
AAGACGCTGGCCCTAAAGGCCGTCGTTCTGCGCGACGGTACTCTCAAGGAAATCGAGGCCCCAGAGGTCGTACCC
GGCGATATCCTGCAGGTCGAAGAGGTGAGTGATTTTTTTTTCCAAAAAAAAACATTCTCCACCTTACCCATCATC
GTGGGCCTCCATGACGTATGTCGTACACGTGCTGACTAGCGCATTACAGGGCACCATCATCCCCGCCGACGGACG
CATCGTGACCGAAGATGCCTTCCTCCAGGTCGATCAGTCGGCCATCACGGGCGAGTCGCTCGCCGTCGACAAGCA
CAAGAATGACAGCTGTTTCGCTTCCTCGGCCGTCAAGCGTGGCGAGGCCTTCTTGGTGGTCACCGCCACCGGCGA
CAACACCTTCGTCGGCCGCGCTGCCGCCCTCGTCTCCCAGTCCGCCGGCGGCACCGGTCACTTCACAGAGGTGCT
CAACGGCATCGGCACCGTCCTGCTGATCCTCGTCGTCGTCACCCTGCTCGTCGTCTGGACCTCGTCCTTCTATCG
CTCCAATCCCATCGTCAAGATCCTGCGCTTCACCCTGGCCATCACCATCGTCGGCGTCCCCGTCGGTCTACCCGC
TGTCGTCACCACCACCATGGCCGTCGGCGCCGCCTACCTCGCCAAGAAGCAGGCCATTGTCCAGAAGCTGTCGGC
CATCGAGTCCCTGGCTGGTGTCGAGATCCTCTGCTCCGACAAGACGGGCACCCTGACAAAGAACAAGCTGTCGCT
TTCGGAGCCCTTTACCGTTCCCGGCGTCGACCCCGACGACCTGATGCTGACGGCCTGCTTGGCTGCCTCGCGCAA
GAAGAAGGGTATCGACGCCATCGACAAGGCCTTCCTCAAGGCGCTCAAGTACTACCCCCGCGCCAAGAGTGTCCT
GTCCAAGTACAAGGTGCTCGATTTCCATCCCTTCGATCCCGTCTCGAAAAAGGTGCAGGCCGTCGTCGAGTCGCC
TCAGGGCGAGCGCATCATCTGCGTCAAGGGAGCGCCGCTCTTCGTCCTCAAGACCGTCGAGGAGGACCACCCGAT
CCCCGAGTCCATCGACAAGGCCTACAAGAACTGCGTCGCCGAGTTCGCCACCCGCGGCTTCCGTTCGCTCGGTGT
CGCCCGCAAGCGCGGCGAGGGTGCCTGGGAGATTCTCGGCATCATGCCCTGCTCCGATCCTCCTCGTCACGACAC
GGCCAGGACCATCAACGAGGCCAAGCTGCTGGGTCTGTCCATCAAGATGTTGACGGGTGACGCCGTCGGCATCGC
CCGTGAGACGTCTCGTCAGCTCGGCCTCGGCACCAACGTCTACAACGCCGAGCGGCTCGGTCTCGGCGGCGGCGG
CGACATGCCCGGCTCCGAGGTGTACGATTTCGTCGAGGCCGCCGACGGTTTCGCCGAGGTGTTCCCCCAGCACAA
GTACTCGGTCGTCGAGATCCTGCAGCAGCGTGGCTACCTCGTCGCCATGACCGGAGACGGTGTCAACGACGCGCC
CTCGCTGAAGAAGGCAGACACGGGCATCGCCGTCGAGGGGGCCTCCGACGCCGCCCGATCCGCCGCCGACATCGT
CTTTCTCGCGCCCGGCCTCGGGGCCATTATCGATGCCCTCAAGACGTCGCGCCAGATCTTCCACCGCATGTACGC
CTACGTCGTCTACCGTATTGCCCTGTCCCTTCACATGGAGATCTTCCTCGGCCTCTGGATCGCCATCCTGAACCG
CAGTCTCAACATTGAGCTCATCGTCTTCATCGCCATCTTCGCCGACATCGCCACGCTGGCCATTGCCTACGACAA
CGCCCCCTTCTCGCAGACGCCCGTCAAGTGGAACCTCCCCAAGCTCTGGGGCATGTCGGTCCTGCTGGGCGTCGT
CCTGGCCATTGGCACCTGGATCACGCTGACGACCATGTACGCCGGCGGCGAGGGACGCGGTATCATCCAGAACTT
TGGCAACATGGACGAGGTGCTTTTCCTCGAAATCTCGCTGACGGAGAACTGGCTCATCTTCATCACGCGTGCCAA
CGGGCCATTTTGGTCGTCGATTCCGTCGTGGCAGCTCAGCGGCGCCATCTTCCTCGTCGACATCATCGCCACCCT
GTTCTGCATCTTCGGCTGGTTCGAACATGGGCACCAGACGAGCATCGTGGCCGTGGTCCGGATCTGGATCTTCTC
CTTCGGCATCTTCGCCGTCATGGGCGGCCTGTACTACTTCATGCAGGGCTCCGCGGGCTTCGACAGCCTGATGCA
CGGCAAGTCCCCGAAGCGGAACCAGAAGCAGCGATCACTGGAAGACTTTGGTGAGTCTCGTTTCCCCCCCCCCCT
TCTCGCGCCTCGAAACGAAGCTGACGAGGCGGCAGTCGTCTCCCTGCAGCGTGTCTCGACTCAGCACGAGAAGTC
TCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail