Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01580
Gene name
Locationscaffold_01:5387914..5390883
Strand+
Gene length (bp)2969
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal|Nuclear export signal 0.4359 0.8492 0.0209 0.0377 0.1542 0.0554 0.0407 0.0552 0.1125 0.0241

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 41.42 23.68 59.16
Alive In ants, during behavior modification 57.42 31.97 82.87
Dead In ants, recently dead 64.35 36.83 91.86

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.084138 no
Alive Dead 0.543700 no
Dead Fungus 0.014911 yes

Orthologs

Orthofinder run ID4
Orthogroup2550
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1390
Ophiocordyceps australis map64 (Brazil) OphauB2|3696
Ophiocordyceps camponoti-floridani Ophcf2|01580 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1217
Ophiocordyceps kimflemingae Ophio5|5583
Ophiocordyceps subramaniannii Hirsu2|3777

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01580
MSRTLTSAACRTVIDLTNDDEPAREEGAVRSSKVRVVGEVSGRAAVRLVGDGRAVKPETFRVPARGLPPGHRWFH
LDALPYLPASERDLIARGAKKAVSWAGRTEWPLVYHVDFTAEEVARMLKHLSKLLLEELPPTMRCLTALCFRHHV
PSLVGDVIPRRTEQDVYNFCADLIAGKVPDLQRARTLSLDVEVEAGRRSELQSSRLSSLLLARELEGGAGFGRTR
RYANFQNEFKRAHEDSLAVVAEFTGCAGDVAAVSWVSDGEVICGTTAHSDAHNQQYNKPGNLLVGSVEAGTLRAL
DHHRIPRPRVEKGDNASEAMRQSQDPWLYCSVVSSDYDAISRRAFTSSFDWTVKVWEMESGGIKCVGTWHHGGNV
NFVEAARDGSGRVATAADVSSQAVRIYSLRQDDVSASPYLALSSTRSSGQSWAYFPATMRWGRAPTSRHLLLVGY
SPRGQGGDVDIPEDRRNTGELMLWDASRAVRVPVLAATTANVFEVAWHPTMCRFIVATSPSGLPTEKQQRVRTQI
RIFQQDLDRADGAYSEFQKLDCAAADINELTMMPNSLRHAYVTAGCTDGIVYVWDTAQGDDVLHLLRHGDPLDDF
SHDREKEDTGVKFTAWETTGFLSSA*
Coding >Ophcf2|01580
ATGAGCAGGACGCTCACGTCTGCGGCGTGCAGGACGGTGATTGACCTGACCAACGACGACGAGCCCGCGCGTGAG
GAGGGGGCGGTTCGGAGCTCCAAGGTTCGCGTTGTTGGCGAGGTCTCTGGACGCGCTGCTGTTAGGCTCGTGGGC
GATGGTCGAGCCGTTAAGCCTGAGACTTTCAGAGTGCCGGCTCGTGGGCTTCCGCCTGGTCATAGGTGGTTCCAT
CTCGACGCGTTGCCTTATCTTCCGGCATCCGAGCGGGATCTCATCGCCCGGGGAGCGAAGAAGGCAGTTTCGTGG
GCTGGCAGGACAGAATGGCCCCTCGTCTACCACGTTGACTTCACGGCCGAGGAGGTTGCTAGAATGTTGAAGCAC
CTGTCCAAGCTTCTCCTGGAGGAGCTGCCGCCGACGATGCGGTGTTTGACGGCGCTTTGCTTCCGACACCACGTT
CCGTCTCTCGTGGGCGACGTCATACCGCGGCGAACAGAGCAGGACGTTTACAACTTCTGCGCCGATCTCATAGCT
GGCAAGGTGCCGGATTTGCAGCGGGCGAGAACGCTTTCGCTAGACGTCGAGGTCGAGGCCGGACGACGGTCCGAG
TTGCAAAGCAGTCGGCTTTCTTCACTGCTGCTGGCGAGGGAGCTGGAGGGGGGCGCAGGATTCGGACGGACGAGA
CGGTACGCGAATTTCCAGAATGAGTTCAAGCGGGCGCACGAGGATTCATTGGCTGTTGTTGCCGAGTTTACGGGC
TGCGCTGGCGATGTTGCTGCCGTGTCGTGGGTGTCGGATGGCGAGGTTATCTGCGGGACGACGGCGCATTCTGAC
GCGCATAACCAACAGTATAACAAGCCCGGGAATCTACTCGTTGGCTCCGTCGAAGCCGGCACGCTACGAGCCTTG
GATCATCATCGGATCCCGAGGCCGAGGGTGGAAAAGGGCGATAACGCGAGCGAGGCGATGCGTCAGAGTCAGGAC
CCGTGGCTGTACTGCTCCGTCGTGTCTTCAGACTACGATGCCATCAGCCGTCGGGCCTTCACGTCTAGCTTCGAC
TGGACCGTCAAGGTCTGGGAGATGGAGTCGGGTGGTATCAAGTGCGTTGGCACGTGGCATCACGGAGGAAACGTC
AACTTCGTCGAGGCTGCTCGTGACGGTTCGGGTCGTGTGGCGACGGCAGCAGACGTGTCTTCGCAGGCAGTTCGC
ATCTACAGCCTACGACAGGACGACGTCAGCGCCAGTCCCTACCTCGCCCTATCTTCGACACGCAGCAGCGGCCAG
TCATGGGCATACTTTCCCGCGACGATGCGTTGGGGAAGGGCTCCCACGTCGAGACATCTCCTTCTAGTCGGATAC
TCACCCCGAGGGCAAGGCGGCGACGTCGATATCCCCGAAGACCGGCGTAACACGGGCGAGCTGATGCTCTGGGAC
GCGTCTCGGGCGGTTCGCGTCCCGGTGCTTGCGGCCACGACGGCAAACGTCTTCGAAGTGGCCTGGCACCCAACA
ATGTGTCGCTTCATCGTCGCCACCTCCCCCAGCGGCCTGCCGACGGAGAAGCAGCAGCGCGTCCGCACGCAGATC
CGAATCTTCCAGCAGGACCTCGACCGGGCAGACGGCGCATACAGCGAATTCCAGAAGCTGGACTGCGCCGCCGCA
GATATCAACGAGCTGACCATGATGCCCAACTCGTTACGACACGCCTACGTCACGGCTGGATGCACGGATGGCATC
GTTTACGTGTGGGATACGGCCCAGGGTGACGACGTCTTGCACCTCCTTCGTCACGGCGATCCTCTGGATGACTTT
TCCCATGATCGTGAGAAGGAAGACACGGGCGTCAAGTTTACGGCTTGGGAGACCACCGGATTCCTTTCCTCTGCT
TGA
Transcript >Ophcf2|01580
ATGAGCAGGACGCTCACGTCTGCGGCGTGCAGGACGGTGATTGACCTGACCAACGACGACGAGCCCGCGCGTGAG
GAGGGGGCGGTTCGGAGCTCCAAGGTTCGCGTTGTTGGCGAGGTCTCTGGACGCGCTGCTGTTAGGCTCGTGGGC
GATGGTCGAGCCGTTAAGCCTGAGACTTTCAGAGTGCCGGCTCGTGGGCTTCCGCCTGGTCATAGGTGGTTCCAT
CTCGACGCGTTGCCTTATCTTCCGGCATCCGAGCGGGATCTCATCGCCCGGGGAGCGAAGAAGGCAGTTTCGTGG
GCTGGCAGGACAGAATGGCCCCTCGTCTACCACGTTGACTTCACGGCCGAGGAGGTTGCTAGAATGTTGAAGCAC
CTGTCCAAGCTTCTCCTGGAGGAGCTGCCGCCGACGATGCGGTGTTTGACGGCGCTTTGCTTCCGACACCACGTT
CCGTCTCTCGTGGGCGACGTCATACCGCGGCGAACAGAGCAGGACGTTTACAACTTCTGCGCCGATCTCATAGCT
GGCAAGGTGCCGGATTTGCAGCGGGCGAGAACGCTTTCGCTAGACGTCGAGGTCGAGGCCGGACGACGGTCCGAG
TTGCAAAGCAGTCGGCTTTCTTCACTGCTGCTGGCGAGGGAGCTGGAGGGGGGCGCAGGATTCGGACGGACGAGA
CGGTACGCGAATTTCCAGAATGAGTTCAAGCGGGCGCACGAGGATTCATTGGCTGTTGTTGCCGAGTTTACGGGC
TGCGCTGGCGATGTTGCTGCCGTGTCGTGGGTGTCGGATGGCGAGGTTATCTGCGGGACGACGGCGCATTCTGAC
GCGCATAACCAACAGTATAACAAGCCCGGGAATCTACTCGTTGGCTCCGTCGAAGCCGGCACGCTACGAGCCTTG
GATCATCATCGGATCCCGAGGCCGAGGGTGGAAAAGGGCGATAACGCGAGCGAGGCGATGCGTCAGAGTCAGGAC
CCGTGGCTGTACTGCTCCGTCGTGTCTTCAGACTACGATGCCATCAGCCGTCGGGCCTTCACGTCTAGCTTCGAC
TGGACCGTCAAGGTCTGGGAGATGGAGTCGGGTGGTATCAAGTGCGTTGGCACGTGGCATCACGGAGGAAACGTC
AACTTCGTCGAGGCTGCTCGTGACGGTTCGGGTCGTGTGGCGACGGCAGCAGACGTGTCTTCGCAGGCAGTTCGC
ATCTACAGCCTACGACAGGACGACGTCAGCGCCAGTCCCTACCTCGCCCTATCTTCGACACGCAGCAGCGGCCAG
TCATGGGCATACTTTCCCGCGACGATGCGTTGGGGAAGGGCTCCCACGTCGAGACATCTCCTTCTAGTCGGATAC
TCACCCCGAGGGCAAGGCGGCGACGTCGATATCCCCGAAGACCGGCGTAACACGGGCGAGCTGATGCTCTGGGAC
GCGTCTCGGGCGGTTCGCGTCCCGGTGCTTGCGGCCACGACGGCAAACGTCTTCGAAGTGGCCTGGCACCCAACA
ATGTGTCGCTTCATCGTCGCCACCTCCCCCAGCGGCCTGCCGACGGAGAAGCAGCAGCGCGTCCGCACGCAGATC
CGAATCTTCCAGCAGGACCTCGACCGGGCAGACGGCGCATACAGCGAATTCCAGAAGCTGGACTGCGCCGCCGCA
GATATCAACGAGCTGACCATGATGCCCAACTCGTTACGACACGCCTACGTCACGGCTGGATGCACGGATGGCATC
GTTTACGTGTGGGATACGGCCCAGGGTGACGACGTCTTGCACCTCCTTCGTCACGGCGATCCTCTGGATGACTTT
TCCCATGATCGTGAGAAGGAAGACACGGGCGTCAAGTTTACGGCTTGGGAGACCACCGGATTCCTTTCCTCTGCT
TGA
Gene >Ophcf2|01580
ATGAGCAGGACGCTCACGTCTGCGGCGTGCAGGACGGTGATTGACCTGACCAACGACGACGAGCCCGCGCGGTCC
GAAGCCGGGGGGGGCCTCGGGGGAGGCCTTGGGGGAGTCCGGGGGTGAAGAGGCGACGGGATAGTGAGGAGGGGG
CGGTTCGGAGCTCCAAGGTTCGCGTTGTTGGCGAGGTGAGCGGAGCCTGGGTTCCTTCTCCTTATCTGCCGTGGC
TTAACTGACGGGGTGGCTATAGGTCTCTGGACGCGCTGCTGTTAGGCTCGTGGGCGATGGTCGAGCCGTTAAGCC
TGAGACTTTCAGAGTGCCGGCTCGTGGGCTTCCGCCTGGTCATAGGTGGTTCCATCTCGACGCGTTGCCTTATCT
TCCGGCATCCGAGCGGGATCTCATCGCCCGGGGAGCGAAGAAGGCAGTTTCGTGGGCTGGCAGGACAGAATGGCC
CCTCGTCTACCACGTTGACTTCACGGCCGAGGAGGTTGCTAGAATGTTGAAGCACCTGTCCAAGCTTCTCCTGGA
GGAGCTGCCGCCGACGATGCGGTGTTTGACGGCGCTTTGCTTCCGACACCACGTTCCGTCTCTCGTGGGCGACGT
CATACCGCGGCGAACAGAGCAGGACGTTTACAACTTCTGCGCCGATCTCATAGCTGGCAAGGTGCCGGATTTGCA
GCGGGCGAGAACGCTTTCGCTAGACGTCGAGGTCGAGGCCGGACGACGGTCCGAGTTGCAAAGCAGTCGGCTTTC
TTCACTGCTGCTGGCGAGGGAGCTGGAGGGGGGCGCAGGATTCGGACGGACGAGACGGTACGCGAATTTCCAGAA
TGAGTTCAAGCGGGCGCACGAGGATTCATTGGCTGTTGTTGCCGAGTTTACGGGCTGCGCTGGCGATGTTGCTGC
CGTGTCGTGGGTGTCGGATGGCGAGGTTATCTGCGGGACGACGGCGCATTCTGACGCGCATAACCAACAGTATAA
CAAGCCCGGGAATCTACTCGTTGGCTCCGTCGAAGCCGGCACGCTACGAGCCTTGGATCATCATCGGATCCCGAG
GCCGAGGGTGGAAAAGGGCGATAACGCGAGCGAGGCGATGCGTCAGAGTCAGGACCCGTGGCTGTACTGCTCCGT
CGTGTCTTCAGACTACGATGCCATCAGCCGTCGGGCCTTCACGTCTAGCTTCGACTGGACCGTCAAGGTCTGGGA
GATGGAGTCGGGTGGTATCAAGTGCGTTGGCACGTGGCATCACGGAGGAAACGTCAACTTCGTCGAGGCTGCTCG
TGACGGTTCGGGTCGTGTGGCGACGGCAGCAGACGTGTCTTCGCAGGCAGTTCGCATCTACAGCCTACGACAGGA
CGACGTCAGCGCCAGTCCCTACCTCGCCCTATCTTCGACACGCAGCAGCGGCCAGTCATGGGCATACTTTCCCGC
GACGATGCGTTGGGGAAGGGCTCCCACGTCGAGACATCTCCTTCTAGTCGGATACTCACCCCGAGGGCAAGGCGG
CGACGTCGATATCCCCGAAGACCGGCGTAACACGGGCGAGCTGATGCTCTGGGACGCGTCTCGGGCGGTTCGCGT
CCCGGTGCTTGCGGCCACGACGGCAAACGTCTTCGAAGTGGCCTGGCACCCAACAATGTGTCGCTTCATCGTCGC
CACCTCCCCCAGCGGCCTGCCGACGGAGAAGCAGCAGCGCGTCCGCACGCAGATCCGAATCTTCCAGCAGGACCT
CGACCGGGCAGACGGCGCATACAGCGAATTCCAGAAGCTGGACTGCGCCGCCGCAGATATCAACGAGCTGACCAT
GATGCCCAACTCGTTACGACACGCCTACGTCACGGCTGGATGCACGGATGGCATCGTTTACGTGTGGGATACGGC
CCAGGGTGACGACGTCTTGCACCTCCTTCGTCACGGCGATCCTCTGGATGACTTTTCCCATGATCGTGAGAAGGA
AGACACGGGCGTCAAGTTTACGGCTTGGGGTTCGTCACCTGATCGGTTTTATACGGGGTCCAGCGATGGGGTCGT
CAAGGTTTGGAATGTGCGGAATCGGCGAGGGCCTTTGGTACGCGTTTTACTTGAGGCGCCTGGGCCCATCTCTGT
CGGTGCTTTTTCTCCGGATGGGTCGCGGCTCGCGGTCGGTGATGCTACGGGGAGGCTGTTTCTTCTGTCTGTTGA
TCATCGTGATGTGCCGACGGATCCGCTTCTTCCCGACATTCAGGGGAAGAATGATCATGGTCGTCGTCATTGTCA
TGGTCGTCGTCGTCGCCCACGACCTTTTACACCACATCCCGAACCACCACCACCACCACCACCACCATCATCATC
ATCATCTTCATCATCTTCATCGTCGTCAGACGACAACGACGACCCAAACGCACAGCAACATCCTCCTCACCCGCC
CATGTCGATAGCAGCCTACGCCCGAGAAACCTTCCTCGTCGGCAAACAACTAACCCTCCACCCCTCCCCCACAAT
CGGCGCCATCCAAGGCCCCGCCTACGCGACCACAGCCCTCTACCGAAGAGAGGCCCACCTGGACGCCGACCCGCA
GGCGCCGCTGCTGACGGAGTACGAGCGCCTGCAGCGGGCGAGTCGGGACGCGAGTCGGGGGAGGGGCCGGCGGAC
GATGCGGCGGATGAGGAGCGTGAGGCCTAAAGGAGTCGAGGCTCTGAGGGGGGTTGCGGGCGGTTGTTGGGAGGG
GCTCTTGGCTGAGGGGGCGGTTTTGGTGGATGAGGTTGGGGAGGATTGGGGGTTTGTGTATGAGGAGGGGTGGTG
GCATCATGAGGATGATGGGGATGGGGATGGGGATGGGGATGGGGGTGGAATGGTTGGGATGTGATATTCATGTTG
GTATACGAGGATATTAGGTATGGAGGAAGGGCTTGCAGTAATCGGATCGACTCATCCGCAACCCAACTCCCATCC
ACCGCCCTCTTTAAGAGACCACCGGATTCCTTTCCTCTGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail