Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01580
Gene name
Locationscaffold_01:5387914..5390883
Strand+
Gene length (bp)2969
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal|Nuclear export signal 0.4359 0.8492 0.0209 0.0377 0.1542 0.0554 0.0407 0.0552 0.1125 0.0241

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2550
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1390
Ophiocordyceps australis map64 (Brazil) OphauB2|3696
Ophiocordyceps camponoti-floridani Ophcf2|01580 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1217
Ophiocordyceps kimflemingae Ophio5|5583
Ophiocordyceps subramaniannii Hirsu2|3777

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01580
MSRTLTSAACRTVIDLTNDDEPAREEGAVRSSKVRVVGEVSGRAAVRLVGDGRAVKPETFRVPARGLPPGHRWFH
LDALPYLPASERDLIARGAKKAVSWAGRTEWPLVYHVDFTAEEVARMLKHLSKLLLEELPPTMRCLTALCFRHHV
PSLVGDVIPRRTEQDVYNFCADLIAGKVPDLQRARTLSLDVEVEAGRRSELQSSRLSSLLLARELEGGAGFGRTR
RYANFQNEFKRAHEDSLAVVAEFTGCAGDVAAVSWVSDGEVICGTTAHSDAHNQQYNKPGNLLVGSVEAGTLRAL
DHHRIPRPRVEKGDNASEAMRQSQDPWLYCSVVSSDYDAISRRAFTSSFDWTVKVWEMESGGIKCVGTWHHGGNV
NFVEAARDGSGRVATAADVSSQAVRIYSLRQDDVSASPYLALSSTRSSGQSWAYFPATMRWGRAPTSRHLLLVGY
SPRGQGGDVDIPEDRRNTGELMLWDASRAVRVPVLAATTANVFEVAWHPTMCRFIVATSPSGLPTEKQQRVRTQI
RIFQQDLDRADGAYSEFQKLDCAAADINELTMMPNSLRHAYVTAGCTDGIVYVWDTAQGDDVLHLLRHGDPLDDF
SHDREKEDTGVKFTAWETTGFLSSA*
Coding >Ophcf2|01580
ATGAGCAGGACGCTCACGTCTGCGGCGTGCAGGACGGTGATTGACCTGACCAACGACGACGAGCCCGCGCGTGAG
GAGGGGGCGGTTCGGAGCTCCAAGGTTCGCGTTGTTGGCGAGGTCTCTGGACGCGCTGCTGTTAGGCTCGTGGGC
GATGGTCGAGCCGTTAAGCCTGAGACTTTCAGAGTGCCGGCTCGTGGGCTTCCGCCTGGTCATAGGTGGTTCCAT
CTCGACGCGTTGCCTTATCTTCCGGCATCCGAGCGGGATCTCATCGCCCGGGGAGCGAAGAAGGCAGTTTCGTGG
GCTGGCAGGACAGAATGGCCCCTCGTCTACCACGTTGACTTCACGGCCGAGGAGGTTGCTAGAATGTTGAAGCAC
CTGTCCAAGCTTCTCCTGGAGGAGCTGCCGCCGACGATGCGGTGTTTGACGGCGCTTTGCTTCCGACACCACGTT
CCGTCTCTCGTGGGCGACGTCATACCGCGGCGAACAGAGCAGGACGTTTACAACTTCTGCGCCGATCTCATAGCT
GGCAAGGTGCCGGATTTGCAGCGGGCGAGAACGCTTTCGCTAGACGTCGAGGTCGAGGCCGGACGACGGTCCGAG
TTGCAAAGCAGTCGGCTTTCTTCACTGCTGCTGGCGAGGGAGCTGGAGGGGGGCGCAGGATTCGGACGGACGAGA
CGGTACGCGAATTTCCAGAATGAGTTCAAGCGGGCGCACGAGGATTCATTGGCTGTTGTTGCCGAGTTTACGGGC
TGCGCTGGCGATGTTGCTGCCGTGTCGTGGGTGTCGGATGGCGAGGTTATCTGCGGGACGACGGCGCATTCTGAC
GCGCATAACCAACAGTATAACAAGCCCGGGAATCTACTCGTTGGCTCCGTCGAAGCCGGCACGCTACGAGCCTTG
GATCATCATCGGATCCCGAGGCCGAGGGTGGAAAAGGGCGATAACGCGAGCGAGGCGATGCGTCAGAGTCAGGAC
CCGTGGCTGTACTGCTCCGTCGTGTCTTCAGACTACGATGCCATCAGCCGTCGGGCCTTCACGTCTAGCTTCGAC
TGGACCGTCAAGGTCTGGGAGATGGAGTCGGGTGGTATCAAGTGCGTTGGCACGTGGCATCACGGAGGAAACGTC
AACTTCGTCGAGGCTGCTCGTGACGGTTCGGGTCGTGTGGCGACGGCAGCAGACGTGTCTTCGCAGGCAGTTCGC
ATCTACAGCCTACGACAGGACGACGTCAGCGCCAGTCCCTACCTCGCCCTATCTTCGACACGCAGCAGCGGCCAG
TCATGGGCATACTTTCCCGCGACGATGCGTTGGGGAAGGGCTCCCACGTCGAGACATCTCCTTCTAGTCGGATAC
TCACCCCGAGGGCAAGGCGGCGACGTCGATATCCCCGAAGACCGGCGTAACACGGGCGAGCTGATGCTCTGGGAC
GCGTCTCGGGCGGTTCGCGTCCCGGTGCTTGCGGCCACGACGGCAAACGTCTTCGAAGTGGCCTGGCACCCAACA
ATGTGTCGCTTCATCGTCGCCACCTCCCCCAGCGGCCTGCCGACGGAGAAGCAGCAGCGCGTCCGCACGCAGATC
CGAATCTTCCAGCAGGACCTCGACCGGGCAGACGGCGCATACAGCGAATTCCAGAAGCTGGACTGCGCCGCCGCA
GATATCAACGAGCTGACCATGATGCCCAACTCGTTACGACACGCCTACGTCACGGCTGGATGCACGGATGGCATC
GTTTACGTGTGGGATACGGCCCAGGGTGACGACGTCTTGCACCTCCTTCGTCACGGCGATCCTCTGGATGACTTT
TCCCATGATCGTGAGAAGGAAGACACGGGCGTCAAGTTTACGGCTTGGGAGACCACCGGATTCCTTTCCTCTGCT
TGA
Transcript >Ophcf2|01580
ATGAGCAGGACGCTCACGTCTGCGGCGTGCAGGACGGTGATTGACCTGACCAACGACGACGAGCCCGCGCGTGAG
GAGGGGGCGGTTCGGAGCTCCAAGGTTCGCGTTGTTGGCGAGGTCTCTGGACGCGCTGCTGTTAGGCTCGTGGGC
GATGGTCGAGCCGTTAAGCCTGAGACTTTCAGAGTGCCGGCTCGTGGGCTTCCGCCTGGTCATAGGTGGTTCCAT
CTCGACGCGTTGCCTTATCTTCCGGCATCCGAGCGGGATCTCATCGCCCGGGGAGCGAAGAAGGCAGTTTCGTGG
GCTGGCAGGACAGAATGGCCCCTCGTCTACCACGTTGACTTCACGGCCGAGGAGGTTGCTAGAATGTTGAAGCAC
CTGTCCAAGCTTCTCCTGGAGGAGCTGCCGCCGACGATGCGGTGTTTGACGGCGCTTTGCTTCCGACACCACGTT
CCGTCTCTCGTGGGCGACGTCATACCGCGGCGAACAGAGCAGGACGTTTACAACTTCTGCGCCGATCTCATAGCT
GGCAAGGTGCCGGATTTGCAGCGGGCGAGAACGCTTTCGCTAGACGTCGAGGTCGAGGCCGGACGACGGTCCGAG
TTGCAAAGCAGTCGGCTTTCTTCACTGCTGCTGGCGAGGGAGCTGGAGGGGGGCGCAGGATTCGGACGGACGAGA
CGGTACGCGAATTTCCAGAATGAGTTCAAGCGGGCGCACGAGGATTCATTGGCTGTTGTTGCCGAGTTTACGGGC
TGCGCTGGCGATGTTGCTGCCGTGTCGTGGGTGTCGGATGGCGAGGTTATCTGCGGGACGACGGCGCATTCTGAC
GCGCATAACCAACAGTATAACAAGCCCGGGAATCTACTCGTTGGCTCCGTCGAAGCCGGCACGCTACGAGCCTTG
GATCATCATCGGATCCCGAGGCCGAGGGTGGAAAAGGGCGATAACGCGAGCGAGGCGATGCGTCAGAGTCAGGAC
CCGTGGCTGTACTGCTCCGTCGTGTCTTCAGACTACGATGCCATCAGCCGTCGGGCCTTCACGTCTAGCTTCGAC
TGGACCGTCAAGGTCTGGGAGATGGAGTCGGGTGGTATCAAGTGCGTTGGCACGTGGCATCACGGAGGAAACGTC
AACTTCGTCGAGGCTGCTCGTGACGGTTCGGGTCGTGTGGCGACGGCAGCAGACGTGTCTTCGCAGGCAGTTCGC
ATCTACAGCCTACGACAGGACGACGTCAGCGCCAGTCCCTACCTCGCCCTATCTTCGACACGCAGCAGCGGCCAG
TCATGGGCATACTTTCCCGCGACGATGCGTTGGGGAAGGGCTCCCACGTCGAGACATCTCCTTCTAGTCGGATAC
TCACCCCGAGGGCAAGGCGGCGACGTCGATATCCCCGAAGACCGGCGTAACACGGGCGAGCTGATGCTCTGGGAC
GCGTCTCGGGCGGTTCGCGTCCCGGTGCTTGCGGCCACGACGGCAAACGTCTTCGAAGTGGCCTGGCACCCAACA
ATGTGTCGCTTCATCGTCGCCACCTCCCCCAGCGGCCTGCCGACGGAGAAGCAGCAGCGCGTCCGCACGCAGATC
CGAATCTTCCAGCAGGACCTCGACCGGGCAGACGGCGCATACAGCGAATTCCAGAAGCTGGACTGCGCCGCCGCA
GATATCAACGAGCTGACCATGATGCCCAACTCGTTACGACACGCCTACGTCACGGCTGGATGCACGGATGGCATC
GTTTACGTGTGGGATACGGCCCAGGGTGACGACGTCTTGCACCTCCTTCGTCACGGCGATCCTCTGGATGACTTT
TCCCATGATCGTGAGAAGGAAGACACGGGCGTCAAGTTTACGGCTTGGGAGACCACCGGATTCCTTTCCTCTGCT
TGA
Gene >Ophcf2|01580
ATGAGCAGGACGCTCACGTCTGCGGCGTGCAGGACGGTGATTGACCTGACCAACGACGACGAGCCCGCGCGGTCC
GAAGCCGGGGGGGGCCTCGGGGGAGGCCTTGGGGGAGTCCGGGGGTGAAGAGGCGACGGGATAGTGAGGAGGGGG
CGGTTCGGAGCTCCAAGGTTCGCGTTGTTGGCGAGGTGAGCGGAGCCTGGGTTCCTTCTCCTTATCTGCCGTGGC
TTAACTGACGGGGTGGCTATAGGTCTCTGGACGCGCTGCTGTTAGGCTCGTGGGCGATGGTCGAGCCGTTAAGCC
TGAGACTTTCAGAGTGCCGGCTCGTGGGCTTCCGCCTGGTCATAGGTGGTTCCATCTCGACGCGTTGCCTTATCT
TCCGGCATCCGAGCGGGATCTCATCGCCCGGGGAGCGAAGAAGGCAGTTTCGTGGGCTGGCAGGACAGAATGGCC
CCTCGTCTACCACGTTGACTTCACGGCCGAGGAGGTTGCTAGAATGTTGAAGCACCTGTCCAAGCTTCTCCTGGA
GGAGCTGCCGCCGACGATGCGGTGTTTGACGGCGCTTTGCTTCCGACACCACGTTCCGTCTCTCGTGGGCGACGT
CATACCGCGGCGAACAGAGCAGGACGTTTACAACTTCTGCGCCGATCTCATAGCTGGCAAGGTGCCGGATTTGCA
GCGGGCGAGAACGCTTTCGCTAGACGTCGAGGTCGAGGCCGGACGACGGTCCGAGTTGCAAAGCAGTCGGCTTTC
TTCACTGCTGCTGGCGAGGGAGCTGGAGGGGGGCGCAGGATTCGGACGGACGAGACGGTACGCGAATTTCCAGAA
TGAGTTCAAGCGGGCGCACGAGGATTCATTGGCTGTTGTTGCCGAGTTTACGGGCTGCGCTGGCGATGTTGCTGC
CGTGTCGTGGGTGTCGGATGGCGAGGTTATCTGCGGGACGACGGCGCATTCTGACGCGCATAACCAACAGTATAA
CAAGCCCGGGAATCTACTCGTTGGCTCCGTCGAAGCCGGCACGCTACGAGCCTTGGATCATCATCGGATCCCGAG
GCCGAGGGTGGAAAAGGGCGATAACGCGAGCGAGGCGATGCGTCAGAGTCAGGACCCGTGGCTGTACTGCTCCGT
CGTGTCTTCAGACTACGATGCCATCAGCCGTCGGGCCTTCACGTCTAGCTTCGACTGGACCGTCAAGGTCTGGGA
GATGGAGTCGGGTGGTATCAAGTGCGTTGGCACGTGGCATCACGGAGGAAACGTCAACTTCGTCGAGGCTGCTCG
TGACGGTTCGGGTCGTGTGGCGACGGCAGCAGACGTGTCTTCGCAGGCAGTTCGCATCTACAGCCTACGACAGGA
CGACGTCAGCGCCAGTCCCTACCTCGCCCTATCTTCGACACGCAGCAGCGGCCAGTCATGGGCATACTTTCCCGC
GACGATGCGTTGGGGAAGGGCTCCCACGTCGAGACATCTCCTTCTAGTCGGATACTCACCCCGAGGGCAAGGCGG
CGACGTCGATATCCCCGAAGACCGGCGTAACACGGGCGAGCTGATGCTCTGGGACGCGTCTCGGGCGGTTCGCGT
CCCGGTGCTTGCGGCCACGACGGCAAACGTCTTCGAAGTGGCCTGGCACCCAACAATGTGTCGCTTCATCGTCGC
CACCTCCCCCAGCGGCCTGCCGACGGAGAAGCAGCAGCGCGTCCGCACGCAGATCCGAATCTTCCAGCAGGACCT
CGACCGGGCAGACGGCGCATACAGCGAATTCCAGAAGCTGGACTGCGCCGCCGCAGATATCAACGAGCTGACCAT
GATGCCCAACTCGTTACGACACGCCTACGTCACGGCTGGATGCACGGATGGCATCGTTTACGTGTGGGATACGGC
CCAGGGTGACGACGTCTTGCACCTCCTTCGTCACGGCGATCCTCTGGATGACTTTTCCCATGATCGTGAGAAGGA
AGACACGGGCGTCAAGTTTACGGCTTGGGGTTCGTCACCTGATCGGTTTTATACGGGGTCCAGCGATGGGGTCGT
CAAGGTTTGGAATGTGCGGAATCGGCGAGGGCCTTTGGTACGCGTTTTACTTGAGGCGCCTGGGCCCATCTCTGT
CGGTGCTTTTTCTCCGGATGGGTCGCGGCTCGCGGTCGGTGATGCTACGGGGAGGCTGTTTCTTCTGTCTGTTGA
TCATCGTGATGTGCCGACGGATCCGCTTCTTCCCGACATTCAGGGGAAGAATGATCATGGTCGTCGTCATTGTCA
TGGTCGTCGTCGTCGCCCACGACCTTTTACACCACATCCCGAACCACCACCACCACCACCACCACCATCATCATC
ATCATCTTCATCATCTTCATCGTCGTCAGACGACAACGACGACCCAAACGCACAGCAACATCCTCCTCACCCGCC
CATGTCGATAGCAGCCTACGCCCGAGAAACCTTCCTCGTCGGCAAACAACTAACCCTCCACCCCTCCCCCACAAT
CGGCGCCATCCAAGGCCCCGCCTACGCGACCACAGCCCTCTACCGAAGAGAGGCCCACCTGGACGCCGACCCGCA
GGCGCCGCTGCTGACGGAGTACGAGCGCCTGCAGCGGGCGAGTCGGGACGCGAGTCGGGGGAGGGGCCGGCGGAC
GATGCGGCGGATGAGGAGCGTGAGGCCTAAAGGAGTCGAGGCTCTGAGGGGGGTTGCGGGCGGTTGTTGGGAGGG
GCTCTTGGCTGAGGGGGCGGTTTTGGTGGATGAGGTTGGGGAGGATTGGGGGTTTGTGTATGAGGAGGGGTGGTG
GCATCATGAGGATGATGGGGATGGGGATGGGGATGGGGATGGGGGTGGAATGGTTGGGATGTGATATTCATGTTG
GTATACGAGGATATTAGGTATGGAGGAAGGGCTTGCAGTAATCGGATCGACTCATCCGCAACCCAACTCCCATCC
ACCGCCCTCTTTAAGAGACCACCGGATTCCTTTCCTCTGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail