Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01575
Gene name
Locationscaffold_01:5372238..5379311
Strand-
Gene length (bp)7073
Transcript length (bp)6600
Coding sequence length (bp)6600
Protein length (aa) 2200

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 8.2E-40 90 283

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0016209 antioxidant activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.202 0.1075 0.8581 0.1124 0.0739 0.0317 0.2535 0.1926 0.1664 0.0062

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.896411

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 130 152 22
3 240 262 22
4 1815 1837 22
5 1878 1900 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.01 0.0 0.02
Alive In ants, during behavior modification 0.10 0.0 0.22
Dead In ants, recently dead 0.03 0.0 0.08

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 1.0 no
Alive Dead 1.0 no
Dead Fungus 1.0 no

Orthologs

Orthofinder run ID4
Orthogroup10
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01575 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04934
Ophiocordyceps camponoti-floridani Ophcf2|04444
Ophiocordyceps camponoti-floridani Ophcf2|03872
Ophiocordyceps camponoti-floridani Ophcf2|01486
Ophiocordyceps camponoti-floridani Ophcf2|01298
Ophiocordyceps camponoti-rufipedis Ophun1|3812
Ophiocordyceps camponoti-rufipedis Ophun1|2843
Ophiocordyceps camponoti-rufipedis Ophun1|2652
Ophiocordyceps camponoti-rufipedis Ophun1|1703
Ophiocordyceps camponoti-rufipedis Ophun1|4097
Ophiocordyceps camponoti-rufipedis Ophun1|5039
Ophiocordyceps kimflemingae Ophio5|3515
Ophiocordyceps kimflemingae Ophio5|6027
Ophiocordyceps kimflemingae Ophio5|5537
Ophiocordyceps kimflemingae Ophio5|1636
Ophiocordyceps kimflemingae Ophio5|1831
Ophiocordyceps kimflemingae Ophio5|3860
Ophiocordyceps subramaniannii Hirsu2|176
Ophiocordyceps subramaniannii Hirsu2|2725
Ophiocordyceps subramaniannii Hirsu2|3527
Ophiocordyceps subramaniannii Hirsu2|4531
Ophiocordyceps subramaniannii Hirsu2|8567
Ophiocordyceps subramaniannii Hirsu2|4975
Ophiocordyceps subramaniannii Hirsu2|5395
Ophiocordyceps subramaniannii Hirsu2|5900
Ophiocordyceps subramaniannii Hirsu2|5920
Ophiocordyceps subramaniannii Hirsu2|7409
Ophiocordyceps subramaniannii Hirsu2|7976
Ophiocordyceps subramaniannii Hirsu2|8011
Ophiocordyceps subramaniannii Hirsu2|1636

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01575
MVGRKLWLFALCGIDAVVGFSQLASLSHTLQQALGNSSIQADSTAQRTQELLMSSSIQQVLMNSYANIESLKAST
AEHLMAGYDTLWEKHPYIPPGPNDSRSPCPTLNALANHGYFRRDGKNLFLPDMLIGLFLGVGLSPELGAIILAFA
ILSAEKPLTGSISLRDLATHETGIEHDCSMSRKDHAIGDDGIFDPESWAVAYQEMKKSKILNPIRMGQAKAARVK
DARRVNPKTLFGPKAWFNGYAELGLILSVFGFFPGLAKLEVIKTVFEEERLPYDLGWRPYPFVANTPVVLAVGAI
SVLGDTDAFGTYGSVVSGEPTEILQVFLPPSLDHLPELEKLIGNLGFNNGPMKLLSGVMRSISKQKNPVAEEEKL
VGDKGFHGSGAMPFDAPPPGSGLQSLGGQDKRTGLPADVIGTLKRLLGLGNKEPGLGSGSSGGLGGFNPSSGSPT
NGNGGYNNLNSGNGVFNNPNNGYGGFNNPGGYNNNGNTGYNNPGGYNNNGNTGFNNPGGFRPGSGSPGYPYTGNG
GYNNLGNYPNYGKGGYNSPGGYNNNNGNRGFTNPNNGNRGFNNPYPNYSYGGNRDFNNPNNGNRGFVNQNPNYSY
SGNSVRGTSPNPGSSGYYFTYNSNGRGGSGFFESNNNNVRGNYNNLRARDLSSSVPQYSNIFDPDDFDPDNDPDL
DVDFDTDGNAIPWTPHFPPSDPHSYDPKGSGGSPSRPGNNGPSNSDYGPDPNGPGGPDGYGGSSTYPGTSGGSGS
KPKGPGGSPSRPGNGSPSNPGYGPDPNGPGGIDGYGGSSNYPGTSGGPGSNPNTYGKPKGSGVSPSNPGRPGSVP
GNSGNNGPSSPGYGPDPNGPGGPDGYGGSGNNPGYPGSSGGNPNGPGSSPGRTRPGGPGSSPGTGGNGPSNPGYD
SDPYGPGGPNNYGGPGNNPKSPGGSGGNPKNPRPGSGGPGSSPSNPGYNNDPGYGNPGYGNPGYGDSNPNNYGNP
NSGSPNGPGDNPYNPGSGPRGPGSSPGNPGYGGGTGSSPNPDYGNSSPTGPGGFPGNSGNPVALAATPIYRALDL
EDPAAHLAIQDTATLQGIPTVKEAQDLEDLITSLVTPVTATLQGIPTVQEAQDLEDLAVSLATPVTATLQAIPTA
QEAQDLEGRVANRATLGTAVPEILGTEIRTAQEALDPGDLAVNPTTQDTATLRVTPTAQEARGLEDRAANQATLD
TTVPVIQDTETRTVQEVLPPEDLANNLTTLDTTVPVIQVTETRTVQEVLVPEDLAANQATLDTTVPVIQDTETRT
VQEALPPEDLADNLTTLDTTTPATQDTETRTVQEVPAPEDLADNLATRDTATRTPMAQEVPATEDLAAHLTILDT
TTLATQVTETRTAQGVPIPTGVPATLGTTGPAIQDTETQVVQEVPMDMKAATLDLLAATPTAQEVLLESPDLLEL
AARQATQDIAMGLATLETTDLTARLTARGTVADLTTRLMARGTAVGLTARLIAQHTAMGQTARDTVTGLTTRLTA
HGTAADLTARLMARGTAVDLTDRLIARYTAMAQTTRDTAADLGTHLTTPVTDREIQDTTDRGARLTLRDTVTGLE
AREYGNGSPGDGVGPSNPGYGDGPGSPGYGNEPGGPPSNPGSGGSSPGSGSPGNTGPSSPPDNPGYGDGPGNPPS
NPGYGDGPNSPPSNPGYGGSNPGSGSPSNGGPGNPPSNPGYGDGPGNPPTNPPSNPGYSDGPGNPPNKPGYGDGP
SNPPNNPGYSDGPGNPPSNPPSNPGYGDGPDTPPSNPGYGEGPNISPDDPGYGDTDPGYGESNPDGSDNPNGPPD
GPPDGPPDGPPDGPLMAPLMVLLMVLLMVLLMVRLKIRDTEILAVREVRTATEVATLGPLTVLQTVLQTVLQTVL
QTVLLTVLLTVLLTVLLTALLMVRLKIRDTEILAVREVRTATEVATLGLPTILQTVLQTVLQTVPLTVPLTVPLT
ALLVILPKTPGYDPNGSEGPGYDPNGPTNPGYNPNGPGGNGPDNNPGNNPPGYNNPNNPSDPSYNPNGPAVDPNS
LADPGYGNPSYSDPSTTPGSTSSNPIKDLLDKGQSIGGKLFPEGSPLALGGTVGKTQNGGLGFDVNGGIGVPGLG
LNLGLSGAADGKKVGLNNNVGITLGDKTYGINLNNGLGNNGAGITPFSNAQAGSNPLDPGSTLGAYDPNKKGAQG
GGVDFVDQARNLKVPGGINNLLGL*
Coding >Ophcf2|01575
ATGGTGGGCCGAAAGCTATGGCTCTTTGCCCTCTGCGGCATAGACGCCGTCGTCGGCTTCTCGCAACTGGCCAGC
CTTTCACACACGCTGCAGCAGGCACTGGGCAACAGCTCCATACAAGCTGACAGCACAGCTCAGAGGACCCAAGAG
TTGCTGATGAGCAGCTCGATACAGCAAGTCTTGATGAATAGCTATGCCAACATCGAGTCTCTCAAGGCGTCGACG
GCTGAGCACTTGATGGCCGGATACGATACGCTGTGGGAGAAGCATCCGTATATCCCCCCTGGACCCAACGACTCA
CGAAGCCCCTGTCCCACTCTCAACGCCCTCGCCAACCACGGCTACTTCCGCCGCGATGGCAAGAACCTCTTTCTC
CCCGATATGCTCATCGGCCTCTTCCTCGGCGTCGGTCTCTCCCCGGAGTTGGGCGCCATCATCTTGGCCTTTGCC
ATCCTCTCAGCCGAAAAGCCCTTGACGGGTTCCATAAGTCTCCGTGATCTAGCGACGCACGAGACGGGCATCGAA
CACGATTGCAGCATGTCTCGAAAGGACCATGCCATCGGTGACGACGGCATCTTCGATCCCGAGTCCTGGGCCGTT
GCCTATCAAGAGATGAAGAAGAGTAAGATTCTGAATCCGATTCGTATGGGTCAGGCCAAAGCCGCGCGTGTCAAA
GACGCCAGGAGAGTGAATCCCAAGACCCTCTTCGGGCCCAAAGCTTGGTTCAACGGCTACGCTGAGCTGGGCCTC
ATCCTATCCGTCTTCGGCTTCTTTCCCGGCCTGGCCAAGCTCGAGGTAATCAAGACCGTCTTCGAGGAGGAGAGA
TTGCCGTATGATCTCGGCTGGCGGCCTTATCCCTTTGTTGCAAACACGCCCGTCGTTCTCGCCGTCGGCGCCATA
TCCGTCCTCGGTGATACCGACGCCTTTGGAACTTATGGCAGCGTTGTTAGCGGGGAACCAACGGAAATCCTGCAA
GTCTTCTTACCCCCTAGTCTCGACCACCTCCCCGAGCTCGAGAAGCTCATTGGCAACCTTGGCTTCAACAACGGT
CCGATGAAGCTCCTCAGCGGCGTCATGAGAAGCATCTCAAAGCAGAAGAACCCGGTGGCGGAGGAGGAGAAACTG
GTCGGAGACAAGGGCTTCCACGGTTCCGGAGCCATGCCCTTCGACGCCCCGCCCCCAGGCTCCGGTCTTCAATCC
CTGGGCGGCCAGGACAAGAGGACCGGTCTTCCCGCCGATGTAATCGGTACTCTCAAGCGTCTTCTCGGTCTGGGC
AACAAGGAACCGGGTCTGGGTTCCGGTAGTTCTGGCGGTTTGGGGGGCTTCAATCCTAGCTCTGGATCTCCTACC
AACGGCAATGGCGGCTATAATAATCTGAACAGCGGCAATGGCGTCTTTAATAATCCAAACAACGGTTACGGCGGC
TTCAACAATCCAGGAGGCTATAACAACAACGGTAATACTGGCTACAACAACCCAGGAGGCTACAACAACAACGGC
AACACTGGCTTCAACAACCCAGGAGGCTTTCGTCCAGGCTCTGGGTCTCCTGGGTATCCTTACACCGGTAATGGC
GGTTATAACAATCTAGGAAATTATCCCAACTATGGTAAAGGGGGCTACAACAGCCCGGGGGGTTATAACAACAAC
AACGGCAATAGAGGCTTTACTAACCCTAACAACGGTAACCGCGGCTTTAACAACCCATACCCTAATTACAGTTAC
GGCGGCAATAGGGACTTCAACAACCCTAACAACGGTAACCGCGGCTTTGTCAATCAAAACCCCAATTACAGCTAT
AGCGGCAACAGCGTACGAGGCACTAGTCCTAACCCTGGATCGTCTGGATACTATTTCACTTACAATTCTAATGGC
CGAGGAGGCTCTGGATTCTTTGAAAGCAACAACAACAACGTGAGAGGTAACTACAACAACCTCAGAGCCAGGGAC
CTCAGCTCCAGCGTCCCGCAATACAGCAACATCTTTGATCCAGATGATTTCGACCCTGACAACGATCCTGACCTG
GATGTTGATTTCGACACCGATGGAAATGCTATCCCTTGGACTCCACACTTCCCTCCCAGCGATCCTCACAGCTAT
GACCCCAAGGGCTCAGGAGGATCACCCAGTAGACCCGGGAACAACGGCCCAAGCAATTCCGACTACGGCCCAGAC
CCTAACGGTCCGGGAGGGCCCGATGGCTACGGAGGGTCAAGTACTTACCCCGGGACTTCGGGAGGATCTGGCAGC
AAGCCCAAGGGTCCAGGAGGATCCCCCAGTAGACCCGGGAACGGCAGCCCCAGCAATCCGGGATATGGTCCTGAC
CCCAACGGGCCAGGGGGTATCGATGGCTACGGAGGTTCGAGCAACTACCCTGGCACCTCGGGGGGTCCTGGTAGT
AATCCCAACACTTATGGCAAGCCCAAAGGATCAGGGGTATCTCCCAGCAATCCTGGGCGACCTGGCAGTGTGCCT
GGAAACTCTGGAAACAACGGCCCCAGCAGTCCGGGATACGGTCCTGACCCCAACGGCCCAGGAGGTCCCGATGGC
TATGGAGGTTCAGGCAACAACCCCGGTTACCCAGGCAGTTCTGGCGGAAACCCCAACGGCCCGGGAAGCTCTCCA
GGTAGGACCAGACCTGGAGGGCCCGGTAGCTCGCCGGGAACTGGGGGCAATGGTCCTAGCAATCCGGGGTACGAC
TCAGATCCGTACGGCCCGGGAGGTCCCAATAACTACGGAGGTCCGGGTAATAATCCCAAGTCTCCGGGCGGCTCT
GGCGGTAACCCTAAGAACCCGAGACCTGGATCTGGAGGACCCGGTAGCTCGCCTAGCAACCCTGGGTATAACAAC
GACCCAGGGTACGGCAACCCAGGGTACGGCAACCCAGGGTACGGCGACTCTAACCCCAACAACTACGGGAATCCA
AACTCCGGATCTCCGAATGGTCCCGGCGACAACCCTTATAACCCAGGCTCCGGACCCAGAGGACCTGGCAGCTCA
CCTGGCAACCCGGGATACGGCGGGGGAACTGGAAGCTCACCCAACCCAGATTACGGCAACTCCAGTCCCACCGGT
CCAGGAGGCTTCCCTGGAAACTCTGGAAATCCTGTGGCCCTGGCCGCAACCCCAATATACCGGGCTCTGGACCTA
GAGGACCCGGCAGCTCACCTAGCAATCCAGGATACGGCAACCCTACAGGGAATCCCAACGGTCAAGGAGGCTCAA
GACCTGGAGGACCTGATAACCAGCCTAGTAACCCCGGTTACGGCAACCCTACAGGGAATCCCAACGGTCCAGGAG
GCTCAAGACCTGGAGGATCTAGCAGTCAGCCTAGCAACCCCGGTTACGGCAACCCTACAGGCAATCCCAACGGCC
CAGGAGGCTCAAGACCTGGAGGGCCGGGTAGCCAACCGAGCGACCCTGGGTACGGCGGTCCCAGAAATCCTGGGT
ACGGAGATTCGAACGGCCCAGGAAGCTCTAGACCCGGGGGATCTGGCAGTCAACCCAACAACCCAGGATACGGCA
ACCCTACGAGTAACCCCAACGGCCCAGGAGGCTCGAGGCCTGGAGGACCGGGCAGCCAACCAAGCAACCCTGGAT
ACAACGGTCCCAGTAATCCAGGATACGGAGACTCGAACGGTCCAGGAGGTTCTACCCCCGGAGGACCTGGCAAAC
AACCTAACAACCCTGGATACAACGGTCCCAGTAATCCAGGTTACGGAGACCCGAACGGTCCAGGAGGTTCTGGTC
CCGGAGGACCTGGCAGCCAACCAAGCAACCCTGGATACAACGGTCCCAGTAATCCAGGATACGGAGACTCGAACG
GTCCAGGAGGCTCTACCCCCGGAGGACCTAGCAGACAACCTAACAACCCTGGATACAACAACCCCAGCAACCCAG
GATACGGAGACTCGAACGGTCCAGGAGGTTCCGGCCCCGGAGGACCTGGCAGACAACCTAGCAACCCGGGATACG
GCAACTCGAACCCCGATGGCCCAGGAGGTCCCAGCTACGGAGGACCTGGCAGCTCACCTAACAATCCTGGATACA
ACAACCCTAGCAACCCAGGTTACGGAGACTCGAACGGCCCAGGGGGTCCCGATACCTACGGGGGTCCCGGCAACT
CTGGGAACAACGGGCCCAGCAATCCAGGATACGGAGACACAAGTGGTCCAGGAGGTCCCAATGGATATGAAGGCG
GCAACTCTGGATCTCCTGGCGGCAACCCCAACAGCCCAGGAGGTCCTTCTGGAAAGCCCGGATCTTCTGGAACTG
GCAGCTCGCCAAGCAACCCAGGATATAGCGATGGGCCTGGCAACCCTGGAAACGACGGACCTGACAGCTCGTCTG
ACGGCCCGTGGTACGGTGGCGGATCTAACAACTCGCCTGATGGCCCGTGGTACGGCGGTGGGTCTGACGGCTCGC
CTGATAGCCCAGCATACGGCGATGGGCCAGACAGCCCGGGATACGGTAACGGGCCTAACGACTCGCCTGACGGCC
CATGGTACGGCGGCGGATCTAACAGCTCGCCTGATGGCCCGTGGTACGGCGGTGGATCTGACGGATCGCCTGATA
GCCCGGTATACGGCGATGGCTCAGACAACCCGGGATACGGCGGCGGACCTGGGAACTCACCTGACAACCCCGGTG
ACGGACCGGGAAATCCAGGATACAACGGACCGGGGAGCTCGTCTGACGCTCCGGGATACGGTGACGGGCCTGGAA
GCCCGGGAATACGGTAACGGCAGTCCGGGAGACGGCGTCGGACCTAGCAATCCGGGATACGGCGACGGACCTGGC
AGTCCGGGTTACGGCAACGAACCCGGGGGTCCACCTAGCAACCCGGGATCCGGCGGCTCATCTCCAGGCTCTGGA
TCCCCAGGCAATACAGGACCTAGCAGCCCCCCAGACAACCCGGGATACGGTGACGGACCGGGCAACCCACCGAGT
AATCCAGGATACGGCGATGGGCCTAACAGTCCGCCCAGTAACCCAGGATACGGCGGCTCGAATCCCGGCTCCGGG
TCTCCGAGTAATGGAGGTCCCGGTAACCCGCCGAGCAATCCGGGATACGGAGACGGACCTGGCAACCCGCCGACT
AACCCGCCGAGCAACCCGGGATATAGCGATGGACCTGGCAACCCTCCGAACAAGCCAGGATACGGTGACGGACCT
AGCAACCCGCCGAACAACCCAGGGTACAGCGATGGGCCTGGGAATCCGCCCAGCAATCCGCCCAGCAACCCAGGC
TACGGCGACGGACCAGATACTCCGCCCAGCAACCCGGGATATGGTGAAGGACCTAACATTTCCCCGGACGACCCG
GGATACGGTGACACTGACCCCGGCTACGGGGAGTCTAACCCTGACGGTTCCGACAATCCTAACGGTCCCCCTGAT
GGTCCCCCTGATGGTCCCCCTGATGGTCCCCCTGATGGCCCCCTGATGGCCCCCCTGATGGTCCTCCTGATGGTC
CTCCTGATGGTCCTCCTGATGGTCCGCCTGAAAATCCGGGATACGGAGATCCTAGCGGTCCGGGAGGTTCGGACG
GCTACGGAGGTAGCGACTCTGGGTCCCTTAACGGTCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCTC
CAGACGGTCCTCCTAACGGTCCTCCTGACGGTCCTCCTGACGGTCCTCCTGACGGCCCTCCTGATGGTCCGCCTG
AAAATCCGGGATACGGAGATCCTAGCGGTCCGGGAGGTCCGGACGGCTACGGAGGTAGCGACTCTGGGTCTCCCA
ACGATCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCCCCTGACGGTCCCCCTGACGGTCCCCCTGACG
GCCCTCCTAGTAATCCTCCCGAAAACTCCGGGTTACGACCCCAACGGCTCAGAAGGACCAGGTTACGACCCCAAT
GGCCCGACAAACCCGGGCTACAACCCGAACGGCCCGGGAGGTAACGGCCCCGACAACAACCCCGGCAACAACCCG
CCCGGCTACAACAACCCCAACAACCCATCAGACCCAAGCTACAACCCCAACGGCCCAGCAGTCGACCCCAACAGC
CTGGCAGACCCAGGCTACGGCAACCCCAGCTATAGCGACCCCAGCACCACCCCCGGCAGCACGTCCAGCAACCCG
ATCAAGGACCTCCTCGACAAGGGTCAATCCATCGGCGGCAAACTCTTCCCCGAAGGCTCACCCTTGGCCCTGGGC
GGCACGGTGGGAAAAACACAAAACGGCGGGTTGGGCTTCGACGTCAACGGCGGCATCGGCGTCCCCGGCCTGGGC
CTTAACCTCGGTCTATCGGGCGCTGCCGACGGTAAGAAGGTGGGCTTGAATAACAACGTCGGCATCACGTTGGGA
GACAAGACGTACGGCATCAACTTGAACAACGGGCTCGGCAACAACGGCGCCGGAATCACTCCCTTCTCCAACGCC
CAGGCTGGCTCCAACCCTCTCGACCCCGGCTCGACTCTTGGCGCCTACGACCCTAACAAGAAGGGGGCCCAGGGC
GGAGGCGTGGACTTTGTGGACCAGGCTCGGAACTTGAAGGTGCCGGGGGGTATCAACAACCTTCTTGGGTTGTAA
Transcript >Ophcf2|01575
ATGGTGGGCCGAAAGCTATGGCTCTTTGCCCTCTGCGGCATAGACGCCGTCGTCGGCTTCTCGCAACTGGCCAGC
CTTTCACACACGCTGCAGCAGGCACTGGGCAACAGCTCCATACAAGCTGACAGCACAGCTCAGAGGACCCAAGAG
TTGCTGATGAGCAGCTCGATACAGCAAGTCTTGATGAATAGCTATGCCAACATCGAGTCTCTCAAGGCGTCGACG
GCTGAGCACTTGATGGCCGGATACGATACGCTGTGGGAGAAGCATCCGTATATCCCCCCTGGACCCAACGACTCA
CGAAGCCCCTGTCCCACTCTCAACGCCCTCGCCAACCACGGCTACTTCCGCCGCGATGGCAAGAACCTCTTTCTC
CCCGATATGCTCATCGGCCTCTTCCTCGGCGTCGGTCTCTCCCCGGAGTTGGGCGCCATCATCTTGGCCTTTGCC
ATCCTCTCAGCCGAAAAGCCCTTGACGGGTTCCATAAGTCTCCGTGATCTAGCGACGCACGAGACGGGCATCGAA
CACGATTGCAGCATGTCTCGAAAGGACCATGCCATCGGTGACGACGGCATCTTCGATCCCGAGTCCTGGGCCGTT
GCCTATCAAGAGATGAAGAAGAGTAAGATTCTGAATCCGATTCGTATGGGTCAGGCCAAAGCCGCGCGTGTCAAA
GACGCCAGGAGAGTGAATCCCAAGACCCTCTTCGGGCCCAAAGCTTGGTTCAACGGCTACGCTGAGCTGGGCCTC
ATCCTATCCGTCTTCGGCTTCTTTCCCGGCCTGGCCAAGCTCGAGGTAATCAAGACCGTCTTCGAGGAGGAGAGA
TTGCCGTATGATCTCGGCTGGCGGCCTTATCCCTTTGTTGCAAACACGCCCGTCGTTCTCGCCGTCGGCGCCATA
TCCGTCCTCGGTGATACCGACGCCTTTGGAACTTATGGCAGCGTTGTTAGCGGGGAACCAACGGAAATCCTGCAA
GTCTTCTTACCCCCTAGTCTCGACCACCTCCCCGAGCTCGAGAAGCTCATTGGCAACCTTGGCTTCAACAACGGT
CCGATGAAGCTCCTCAGCGGCGTCATGAGAAGCATCTCAAAGCAGAAGAACCCGGTGGCGGAGGAGGAGAAACTG
GTCGGAGACAAGGGCTTCCACGGTTCCGGAGCCATGCCCTTCGACGCCCCGCCCCCAGGCTCCGGTCTTCAATCC
CTGGGCGGCCAGGACAAGAGGACCGGTCTTCCCGCCGATGTAATCGGTACTCTCAAGCGTCTTCTCGGTCTGGGC
AACAAGGAACCGGGTCTGGGTTCCGGTAGTTCTGGCGGTTTGGGGGGCTTCAATCCTAGCTCTGGATCTCCTACC
AACGGCAATGGCGGCTATAATAATCTGAACAGCGGCAATGGCGTCTTTAATAATCCAAACAACGGTTACGGCGGC
TTCAACAATCCAGGAGGCTATAACAACAACGGTAATACTGGCTACAACAACCCAGGAGGCTACAACAACAACGGC
AACACTGGCTTCAACAACCCAGGAGGCTTTCGTCCAGGCTCTGGGTCTCCTGGGTATCCTTACACCGGTAATGGC
GGTTATAACAATCTAGGAAATTATCCCAACTATGGTAAAGGGGGCTACAACAGCCCGGGGGGTTATAACAACAAC
AACGGCAATAGAGGCTTTACTAACCCTAACAACGGTAACCGCGGCTTTAACAACCCATACCCTAATTACAGTTAC
GGCGGCAATAGGGACTTCAACAACCCTAACAACGGTAACCGCGGCTTTGTCAATCAAAACCCCAATTACAGCTAT
AGCGGCAACAGCGTACGAGGCACTAGTCCTAACCCTGGATCGTCTGGATACTATTTCACTTACAATTCTAATGGC
CGAGGAGGCTCTGGATTCTTTGAAAGCAACAACAACAACGTGAGAGGTAACTACAACAACCTCAGAGCCAGGGAC
CTCAGCTCCAGCGTCCCGCAATACAGCAACATCTTTGATCCAGATGATTTCGACCCTGACAACGATCCTGACCTG
GATGTTGATTTCGACACCGATGGAAATGCTATCCCTTGGACTCCACACTTCCCTCCCAGCGATCCTCACAGCTAT
GACCCCAAGGGCTCAGGAGGATCACCCAGTAGACCCGGGAACAACGGCCCAAGCAATTCCGACTACGGCCCAGAC
CCTAACGGTCCGGGAGGGCCCGATGGCTACGGAGGGTCAAGTACTTACCCCGGGACTTCGGGAGGATCTGGCAGC
AAGCCCAAGGGTCCAGGAGGATCCCCCAGTAGACCCGGGAACGGCAGCCCCAGCAATCCGGGATATGGTCCTGAC
CCCAACGGGCCAGGGGGTATCGATGGCTACGGAGGTTCGAGCAACTACCCTGGCACCTCGGGGGGTCCTGGTAGT
AATCCCAACACTTATGGCAAGCCCAAAGGATCAGGGGTATCTCCCAGCAATCCTGGGCGACCTGGCAGTGTGCCT
GGAAACTCTGGAAACAACGGCCCCAGCAGTCCGGGATACGGTCCTGACCCCAACGGCCCAGGAGGTCCCGATGGC
TATGGAGGTTCAGGCAACAACCCCGGTTACCCAGGCAGTTCTGGCGGAAACCCCAACGGCCCGGGAAGCTCTCCA
GGTAGGACCAGACCTGGAGGGCCCGGTAGCTCGCCGGGAACTGGGGGCAATGGTCCTAGCAATCCGGGGTACGAC
TCAGATCCGTACGGCCCGGGAGGTCCCAATAACTACGGAGGTCCGGGTAATAATCCCAAGTCTCCGGGCGGCTCT
GGCGGTAACCCTAAGAACCCGAGACCTGGATCTGGAGGACCCGGTAGCTCGCCTAGCAACCCTGGGTATAACAAC
GACCCAGGGTACGGCAACCCAGGGTACGGCAACCCAGGGTACGGCGACTCTAACCCCAACAACTACGGGAATCCA
AACTCCGGATCTCCGAATGGTCCCGGCGACAACCCTTATAACCCAGGCTCCGGACCCAGAGGACCTGGCAGCTCA
CCTGGCAACCCGGGATACGGCGGGGGAACTGGAAGCTCACCCAACCCAGATTACGGCAACTCCAGTCCCACCGGT
CCAGGAGGCTTCCCTGGAAACTCTGGAAATCCTGTGGCCCTGGCCGCAACCCCAATATACCGGGCTCTGGACCTA
GAGGACCCGGCAGCTCACCTAGCAATCCAGGATACGGCAACCCTACAGGGAATCCCAACGGTCAAGGAGGCTCAA
GACCTGGAGGACCTGATAACCAGCCTAGTAACCCCGGTTACGGCAACCCTACAGGGAATCCCAACGGTCCAGGAG
GCTCAAGACCTGGAGGATCTAGCAGTCAGCCTAGCAACCCCGGTTACGGCAACCCTACAGGCAATCCCAACGGCC
CAGGAGGCTCAAGACCTGGAGGGCCGGGTAGCCAACCGAGCGACCCTGGGTACGGCGGTCCCAGAAATCCTGGGT
ACGGAGATTCGAACGGCCCAGGAAGCTCTAGACCCGGGGGATCTGGCAGTCAACCCAACAACCCAGGATACGGCA
ACCCTACGAGTAACCCCAACGGCCCAGGAGGCTCGAGGCCTGGAGGACCGGGCAGCCAACCAAGCAACCCTGGAT
ACAACGGTCCCAGTAATCCAGGATACGGAGACTCGAACGGTCCAGGAGGTTCTACCCCCGGAGGACCTGGCAAAC
AACCTAACAACCCTGGATACAACGGTCCCAGTAATCCAGGTTACGGAGACCCGAACGGTCCAGGAGGTTCTGGTC
CCGGAGGACCTGGCAGCCAACCAAGCAACCCTGGATACAACGGTCCCAGTAATCCAGGATACGGAGACTCGAACG
GTCCAGGAGGCTCTACCCCCGGAGGACCTAGCAGACAACCTAACAACCCTGGATACAACAACCCCAGCAACCCAG
GATACGGAGACTCGAACGGTCCAGGAGGTTCCGGCCCCGGAGGACCTGGCAGACAACCTAGCAACCCGGGATACG
GCAACTCGAACCCCGATGGCCCAGGAGGTCCCAGCTACGGAGGACCTGGCAGCTCACCTAACAATCCTGGATACA
ACAACCCTAGCAACCCAGGTTACGGAGACTCGAACGGCCCAGGGGGTCCCGATACCTACGGGGGTCCCGGCAACT
CTGGGAACAACGGGCCCAGCAATCCAGGATACGGAGACACAAGTGGTCCAGGAGGTCCCAATGGATATGAAGGCG
GCAACTCTGGATCTCCTGGCGGCAACCCCAACAGCCCAGGAGGTCCTTCTGGAAAGCCCGGATCTTCTGGAACTG
GCAGCTCGCCAAGCAACCCAGGATATAGCGATGGGCCTGGCAACCCTGGAAACGACGGACCTGACAGCTCGTCTG
ACGGCCCGTGGTACGGTGGCGGATCTAACAACTCGCCTGATGGCCCGTGGTACGGCGGTGGGTCTGACGGCTCGC
CTGATAGCCCAGCATACGGCGATGGGCCAGACAGCCCGGGATACGGTAACGGGCCTAACGACTCGCCTGACGGCC
CATGGTACGGCGGCGGATCTAACAGCTCGCCTGATGGCCCGTGGTACGGCGGTGGATCTGACGGATCGCCTGATA
GCCCGGTATACGGCGATGGCTCAGACAACCCGGGATACGGCGGCGGACCTGGGAACTCACCTGACAACCCCGGTG
ACGGACCGGGAAATCCAGGATACAACGGACCGGGGAGCTCGTCTGACGCTCCGGGATACGGTGACGGGCCTGGAA
GCCCGGGAATACGGTAACGGCAGTCCGGGAGACGGCGTCGGACCTAGCAATCCGGGATACGGCGACGGACCTGGC
AGTCCGGGTTACGGCAACGAACCCGGGGGTCCACCTAGCAACCCGGGATCCGGCGGCTCATCTCCAGGCTCTGGA
TCCCCAGGCAATACAGGACCTAGCAGCCCCCCAGACAACCCGGGATACGGTGACGGACCGGGCAACCCACCGAGT
AATCCAGGATACGGCGATGGGCCTAACAGTCCGCCCAGTAACCCAGGATACGGCGGCTCGAATCCCGGCTCCGGG
TCTCCGAGTAATGGAGGTCCCGGTAACCCGCCGAGCAATCCGGGATACGGAGACGGACCTGGCAACCCGCCGACT
AACCCGCCGAGCAACCCGGGATATAGCGATGGACCTGGCAACCCTCCGAACAAGCCAGGATACGGTGACGGACCT
AGCAACCCGCCGAACAACCCAGGGTACAGCGATGGGCCTGGGAATCCGCCCAGCAATCCGCCCAGCAACCCAGGC
TACGGCGACGGACCAGATACTCCGCCCAGCAACCCGGGATATGGTGAAGGACCTAACATTTCCCCGGACGACCCG
GGATACGGTGACACTGACCCCGGCTACGGGGAGTCTAACCCTGACGGTTCCGACAATCCTAACGGTCCCCCTGAT
GGTCCCCCTGATGGTCCCCCTGATGGTCCCCCTGATGGCCCCCTGATGGCCCCCCTGATGGTCCTCCTGATGGTC
CTCCTGATGGTCCTCCTGATGGTCCGCCTGAAAATCCGGGATACGGAGATCCTAGCGGTCCGGGAGGTTCGGACG
GCTACGGAGGTAGCGACTCTGGGTCCCTTAACGGTCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCTC
CAGACGGTCCTCCTAACGGTCCTCCTGACGGTCCTCCTGACGGTCCTCCTGACGGCCCTCCTGATGGTCCGCCTG
AAAATCCGGGATACGGAGATCCTAGCGGTCCGGGAGGTCCGGACGGCTACGGAGGTAGCGACTCTGGGTCTCCCA
ACGATCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCCCCTGACGGTCCCCCTGACGGTCCCCCTGACG
GCCCTCCTAGTAATCCTCCCGAAAACTCCGGGTTACGACCCCAACGGCTCAGAAGGACCAGGTTACGACCCCAAT
GGCCCGACAAACCCGGGCTACAACCCGAACGGCCCGGGAGGTAACGGCCCCGACAACAACCCCGGCAACAACCCG
CCCGGCTACAACAACCCCAACAACCCATCAGACCCAAGCTACAACCCCAACGGCCCAGCAGTCGACCCCAACAGC
CTGGCAGACCCAGGCTACGGCAACCCCAGCTATAGCGACCCCAGCACCACCCCCGGCAGCACGTCCAGCAACCCG
ATCAAGGACCTCCTCGACAAGGGTCAATCCATCGGCGGCAAACTCTTCCCCGAAGGCTCACCCTTGGCCCTGGGC
GGCACGGTGGGAAAAACACAAAACGGCGGGTTGGGCTTCGACGTCAACGGCGGCATCGGCGTCCCCGGCCTGGGC
CTTAACCTCGGTCTATCGGGCGCTGCCGACGGTAAGAAGGTGGGCTTGAATAACAACGTCGGCATCACGTTGGGA
GACAAGACGTACGGCATCAACTTGAACAACGGGCTCGGCAACAACGGCGCCGGAATCACTCCCTTCTCCAACGCC
CAGGCTGGCTCCAACCCTCTCGACCCCGGCTCGACTCTTGGCGCCTACGACCCTAACAAGAAGGGGGCCCAGGGC
GGAGGCGTGGACTTTGTGGACCAGGCTCGGAACTTGAAGGTGCCGGGGGGTATCAACAACCTTCTTGGGTTGTAA
Gene >Ophcf2|01575
ATGGTGGGCCGAAAGCTATGGCTCTTTGCCCTCTGCGGCATAGACGCCGTCGTCGGCTTCTCGCAACTGGCCAGC
CTTTCACACACGCTGCAGCAGGCACTGGGCAACAGCTCCATACAAGCTGACAGCACAGCTCAGAGGACCCAAGAG
TTGCTGATGAGCAGCTCGATACAGCAAGTCTTGATGAATAGCTATGCCAACATCGAGTCTCTCAAGGCGTCGACG
GCTGAGCACTTGATGGCCGGATACGATACGCTGTGGGAGAAGCATCCGTATATCCCCCCTGGACCCAACGACTGT
TAGCCATACCGTTCTTCCCCATCCATTCAGTTCTAAGAGAAGATAGCTGACTGGAAGACTCACAGCACGAAGCCC
CTGTCCCACTCTCAACGCCCTCGCCAACCACGGCTACTTCCGCCGCGATGGCAAGAACCTCTTTCTCCCCGATAT
GCTCATCGGCCTCTTCCTCGGCGTCGGTCTCTCCCCGGAGTTGGGCGCCATCATCTTGGCCTTTGCCATCCTCTC
AGCCGAAAAGCCCTTGACGGGTTCCATAAGTCTCCGTGATCTAGCGACGCACGAGACGGGCATCGAACACGATTG
CAGCATGTCTCGAAAGGACCATGCCATCGGTGACGACGGCATCTTCGATCCCGAGTCCTGGGCCGTTGCCTATCA
AGAGATGAAGAAGAGTAAGATTCTGAATCCGATTCGTATGGGTCAGGCCAAAGCCGCGCGTGTCAAAGACGCCAG
GAGAGTGAATCCCAAGACCCTCTTCGGGCCCAAAGCTTGGTTCAACGGCTACGCTGAGCTGGGCCTCATCCTATC
CGTCTTCGGCTTCTTTCCCGGCCTGGCCAAGCTCGAGGTAATCAAGACCGTCTTCGAGGAGGAGAGATTGCCGTA
TGATCTCGGCTGGCGGCCTTATCCCTTTGTTGCAAACACGCCCGTCGTTCTCGCCGTCGGCGCCATATCCGTCCT
CGGTGATACCGACGCCTTTGGAACTTATGGCAGCGTTGTTAGCGGGGAACCAACGGTAAGTCTTCAATGCCCTCT
TGGAAAGACGAGACTGACGTCGTGTCTTGAAAGGAAATCCTGCAAGTCTTCTTACCCCCTAGTCTCGACCACCTC
CCCGAGCTCGAGAAGCTCATTGGCAACCTTGGCTTCAACAACGGTCCGATGAAGCTCCTCAGCGGCGTCATGAGA
AGCATCTCAAAGCAGAAGAACCCGGTGGCGGAGGAGGAGAAACTGGTCGGAGACAAGGGCTTCCACGGTTCCGGA
GCCATGCCCTTCGACGCCCCGCCCCCAGGCTCCGGTCTTCAATCCCTGGGCGGCCAGGACAAGAGGACCGGTCTT
CCCGCCGATGTAATCGGTACTCTCAAGCGTCTTCTCGGTCTGGGCAACAAGGAACCGGGTGTGAGCTCCGGAGGA
GGGAAAAAGCTTAGCTCGAACTTGGCTAGCTTGCTTAAAATTCCAGGTCTGGGTTCCGGTAGTTCTGGCGGTTTG
GGGGGCTTCAATCCTAGCTCTGGATCTCCTACCAACGGCAATGGCGGCTATAATAATCTGAACAGCGGCAATGGC
GTCTTTAATAATCCAAACAACGGTTACGGCGGCTTCAACAATCCAGGAGGCTATAACAACAACGGTAATACTGGC
TACAACAACCCAGGAGGCTACAACAACAACGGCAACACTGGCTTCAACAACCCAGGAGGCTTTCGTCCAGGCTCT
GGGTCTCCTGGGTATCCTTACACCGGTAATGGCGGTTATAACAATCTAGGAAATTATCCCAACTATGGTAAAGGG
GGCTACAACAGCCCGGGGGGTTATAACAACAACAACGGCAATAGAGGCTTTACTAACCCTAACAACGGTAACCGC
GGCTTTAACAACCCATACCCTAATTACAGTTACGGCGGCAATAGGGACTTCAACAACCCTAACAACGGTAACCGC
GGCTTTGTCAATCAAAACCCCAATTACAGCTATAGCGGCAACAGCGTACGAGGCACTAGTCCTAACCCTGGATCG
TCTGGATACTATTTCACTTACAATTCTAATGGCCGAGGAGGCTCTGGATTCTTTGAAAGCAACAACAACAACGTG
AGAGGTAACTACAACAACCTCAGAGCCAGGGACCTCAGCTCCAGCGTCCCGCAATACAGCAACATCTTTGATCCA
GATGATTTCGACCCTGACAACGATCCTGACCTGGATGTTGATTTCGACACCGATGGAAATGCTATCCCTTGGACT
CCACACTTCCCTCCCAGCGATCCTCACAGCTATGACCCCAAGGGCTCAGGAGGATCACCCAGTAGACCCGGGAAC
AACGGCCCAAGCAATTCCGACTACGGCCCAGACCCTAACGGTCCGGGAGGGCCCGATGGCTACGGAGGGTCAAGT
ACTTACCCCGGGACTTCGGGAGGATCTGGCAGCAAGCCCAAGGGTCCAGGAGGATCCCCCAGTAGACCCGGGAAC
GGCAGCCCCAGCAATCCGGGATATGGTCCTGACCCCAACGGGCCAGGGGGTATCGATGGCTACGGAGGTTCGAGC
AACTACCCTGGCACCTCGGGGGGTCCTGGTAGTAATCCCAACACTTATGGCAAGCCCAAAGGATCAGGGGTATCT
CCCAGCAATCCTGGGCGACCTGGCAGTGTGCCTGGAAACTCTGGAAACAACGGCCCCAGCAGTCCGGGATACGGT
CCTGACCCCAACGGCCCAGGAGGTCCCGATGGCTATGGAGGTTCAGGCAACAACCCCGGTTACCCAGGCAGTTCT
GGCGGAAACCCCAACGGCCCGGGAAGCTCTCCAGGTAGGACCAGACCTGGAGGGCCCGGTAGCTCGCCGGGAACT
GGGGGCAATGGTCCTAGCAATCCGGGGTACGACTCAGATCCGTACGGCCCGGGAGGTCCCAATAACTACGGAGGT
CCGGGTAATAATCCCAAGTCTCCGGGCGGCTCTGGCGGTAACCCTAAGAACCCGAGACCTGGATCTGGAGGACCC
GGTAGCTCGCCTAGCAACCCTGGGTATAACAACGACCCAGGGTACGGCAACCCAGGGTACGGCAACCCAGGGTAC
GGCGACTCTAACCCCAACAACTACGGGAATCCAAACTCCGGATCTCCGAATGGTCCCGGCGACAACCCTTATAAC
CCAGGCTCCGGACCCAGAGGACCTGGCAGCTCACCTGGCAACCCGGGATACGGCGGGGGAACTGGAAGCTCACCC
AACCCAGATTACGGCAACTCCAGTCCCACCGGTCCAGGAGGCTTCCCTGGAAACTCTGGAAATCCTGGTAGCTCA
CCCAGCAACCCGGGGTATGGCAACCCAAGTTACGGCGACTCTAATCCTTACAACTACGGAAATCCAAACTCTGGA
TCCCCGAGTGGCCCTGGCCGCAACCCCAATATACCGGGCTCTGGACCTAGAGGACCCGGCAGCTCACCTAGCAAT
CCAGGATACGGCAACCCTACAGGGAATCCCAACGGTCAAGGAGGCTCAAGACCTGGAGGACCTGATAACCAGCCT
AGTAACCCCGGTTACGGCAACCCTACAGGGAATCCCAACGGTCCAGGAGGCTCAAGACCTGGAGGATCTAGCAGT
CAGCCTAGCAACCCCGGTTACGGCAACCCTACAGGCAATCCCAACGGCCCAGGAGGCTCAAGACCTGGAGGGCCG
GGTAGCCAACCGAGCGACCCTGGGTACGGCGGTCCCAGAAATCCTGGGTACGGAGATTCGAACGGCCCAGGAAGC
TCTAGACCCGGGGGATCTGGCAGTCAACCCAACAACCCAGGATACGGCAACCCTACGAGTAACCCCAACGGCCCA
GGAGGCTCGAGGCCTGGAGGACCGGGCAGCCAACCAAGCAACCCTGGATACAACGGTCCCAGTAATCCAGGATAC
GGAGACTCGAACGGTCCAGGAGGTTCTACCCCCGGAGGACCTGGCAAACAACCTAACAACCCTGGATACAACGGT
CCCAGTAATCCAGGTTACGGAGACCCGAACGGTCCAGGAGGTTCTGGTCCCGGAGGACCTGGCAGCCAACCAAGC
AACCCTGGATACAACGGTCCCAGTAATCCAGGATACGGAGACTCGAACGGTCCAGGAGGCTCTACCCCCGGAGGA
CCTAGCAGACAACCTAACAACCCTGGATACAACAACCCCAGCAACCCAGGATACGGAGACTCGAACGGTCCAGGA
GGTTCCGGCCCCGGAGGACCTGGCAGACAACCTAGCAACCCGGGATACGGCAACTCGAACCCCGATGGCCCAGGA
GGTCCCAGCTACGGAGGACCTGGCAGCTCACCTAACAATCCTGGATACAACAACCCTAGCAACCCAGGTTACGGA
GACTCGAACGGCCCAGGGGGTCCCGATACCTACGGGGGTCCCGGCAACTCTGGGAACAACGGGCCCAGCAATCCA
GGATACGGAGACACAAGTGGTCCAGGAGGTCCCAATGGATATGAAGGCGGCAACTCTGGATCTCCTGGCGGCAAC
CCCAACAGCCCAGGAGGTCCTTCTGGAAAGCCCGGATCTTCTGGAACTGGCAGCTCGCCAAGCAACCCAGGATAT
AGCGATGGGCCTGGCAACCCTGGAAACGACGGACCTGACAGCTCGTCTGACGGCCCGTGGTACGGTGGCGGATCT
AACAACTCGCCTGATGGCCCGTGGTACGGCGGTGGGTCTGACGGCTCGCCTGATAGCCCAGCATACGGCGATGGG
CCAGACAGCCCGGGATACGGTAACGGGCCTAACGACTCGCCTGACGGCCCATGGTACGGCGGCGGATCTAACAGC
TCGCCTGATGGCCCGTGGTACGGCGGTGGATCTGACGGATCGCCTGATAGCCCGGTATACGGCGATGGCTCAGAC
AACCCGGGATACGGCGGCGGACCTGGGAACTCACCTGACAACCCCGGTGACGGACCGGGAAATCCAGGATACAAC
GGACCGGGGAGCTCGTCTGACGCTCCGGGATACGGTGACGGGCCTGGAAGCCCGGGGTATGGTGACGGGCCTGGA
TCTCCGCCAAGCAACCCGGGATACGGTAACGGACCGGGCAGCCCACCTGACAACCCAGAATACGGTAACGGCAGT
CCGGGAGACGGCGTCGGACCTAGCAATCCGGGATACGGCGACGGACCTGGCAGTCCGGGTTACGGCAACGAACCC
GGGGGTCCACCTAGCAACCCGGGATCCGGCGGCTCATCTCCAGGCTCTGGATCCCCAGGCAATACAGGACCTAGC
AGCCCCCCAGACAACCCGGGATACGGTGACGGACCGGGCAACCCACCGAGTAATCCAGGATACGGCGATGGGCCT
AACAGTCCGCCCAGTAACCCAGGATACGGCGGCTCGAATCCCGGCTCCGGGTCTCCGAGTAATGGAGGTCCCGGT
AACCCGCCGAGCAATCCGGGATACGGAGACGGACCTGGCAACCCGCCGACTAACCCGCCGAGCAACCCGGGATAT
AGCGATGGACCTGGCAACCCTCCGAACAAGCCAGGATACGGTGACGGACCTAGCAACCCGCCGAACAACCCAGGG
TACAGCGATGGGCCTGGGAATCCGCCCAGCAATCCGCCCAGCAACCCAGGCTACGGCGACGGACCAGATACTCCG
CCCAGCAACCCGGGATATGGTGAAGGACCTAACATTTCCCCGGACGACCCGGGATACGGTGACACTGACCCCGGC
TACGGGGAGTCTAACCCTGACGGTTCCGACAATCCTAACGGTCCCCCTGATGGTCCCCCTGATGGTCCCCCTGAT
GGTCCCCCTGATGGCCCCCTGATGGCCCCCCTGATGGTCCTCCTGATGGTCCTCCTGATGGTCCTCCTGATGGTC
CGCCTGAAAATCCGGGATACGGAGATCCTAGCGGTCCGGGAGGTTCGGACGGCTACGGAGGTAGCGACTCTGGGT
CCCTTAACGGTCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCTCCTAACGGTCCTC
CTGACGGTCCTCCTGACGGTCCTCCTGACGGCCCTCCTGATGGTCCGCCTGAAAATCCGGGATACGGAGATCCTA
GCGGTCCGGGAGGTCCGGACGGCTACGGAGGTAGCGACTCTGGGTCTCCCAACGATCCTCCAGACGGTCCTCCAG
ACGGTCCTCCAGACGGTCCCCCTGACGGTCCCCCTGACGGTCCCCCTGACGGCCCTCCTAGTAATCCTCCCGAAA
ACTCCGGGTACGGAGATCCCAACGGTCCGGGAGGCCCAGACGGCTACGGAGGTAACCCCTCTGGTTCTCCCAACG
ATCCTGGCAACAACCCTTCTAGCTACAACAATCCCAAAGACCCAGATGGACCAGGTTACGACCCCAACGGCTCAG
AAGGACCAGGTTACGACCCCAATGGCCCGACAAACCCGGGCTACAACCCGAACGGCCCGGGAGGTAACGGCCCCG
ACAACAACCCCGGCAACAACCCGCCCGGCTACAACAACCCCAACAACCCATCAGACCCAAGCTACAACCCCAACG
GCCCAGCAGTCGACCCCAACAGCCTGGCAGACCCAGGCTACGGCAACCCCAGCTATAGCGACCCCAGCACCACCC
CCGGCAGCACGTCCAGCAACCCGATCAAGGACCTCCTCGACAAGGGTCAATCCATCGGCGGCAAACTCTTCCCCG
AAGGCTCACCCTTGGCCCTGGGCGGCACGGTGGGAAAAACACAAAACGGCGGGTTGGGCTTCGACGTCAACGGCG
GCATCGGCGTCCCCGGCCTGGGCCTTAACCTCGGTCTATCGGGCGCTGCCGACGGTAAGAAGGTGGGCTTGAATA
ACAACGTCGGCATCACGTTGGGAGACAAGACGTACGGCATCAACTTGAACAACGGGCTCGGCAACAACGGCGCCG
GAATCACTCCCTTCTCCAACGCCCAGGCTGGCTCCAACCCTCTCGACCCCGGCTCGACTCTTGGCGCCTACGACC
CTAACAAGAAGGGGGCCCAGGGCGGAGGCGTGGACTTTGTGGACCAGGCTCGGAACTTGAAGGTGCCGGGGGGTA
TCAACAACCTTCTTGGGTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail