Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01575
Gene name
Locationscaffold_01:5372238..5379311
Strand-
Gene length (bp)7073
Transcript length (bp)6600
Coding sequence length (bp)6600
Protein length (aa) 2200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 8.2E-40 90 283

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0016209 antioxidant activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 130 152 22
3 240 262 22
4 1815 1837 22
5 1878 1900 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01575
MVGRKLWLFALCGIDAVVGFSQLASLSHTLQQALGNSSIQADSTAQRTQELLMSSSIQQVLMNSYANIESLKAST
AEHLMAGYDTLWEKHPYIPPGPNDSRSPCPTLNALANHGYFRRDGKNLFLPDMLIGLFLGVGLSPELGAIILAFA
ILSAEKPLTGSISLRDLATHETGIEHDCSMSRKDHAIGDDGIFDPESWAVAYQEMKKSKILNPIRMGQAKAARVK
DARRVNPKTLFGPKAWFNGYAELGLILSVFGFFPGLAKLEVIKTVFEEERLPYDLGWRPYPFVANTPVVLAVGAI
SVLGDTDAFGTYGSVVSGEPTEILQVFLPPSLDHLPELEKLIGNLGFNNGPMKLLSGVMRSISKQKNPVAEEEKL
VGDKGFHGSGAMPFDAPPPGSGLQSLGGQDKRTGLPADVIGTLKRLLGLGNKEPGLGSGSSGGLGGFNPSSGSPT
NGNGGYNNLNSGNGVFNNPNNGYGGFNNPGGYNNNGNTGYNNPGGYNNNGNTGFNNPGGFRPGSGSPGYPYTGNG
GYNNLGNYPNYGKGGYNSPGGYNNNNGNRGFTNPNNGNRGFNNPYPNYSYGGNRDFNNPNNGNRGFVNQNPNYSY
SGNSVRGTSPNPGSSGYYFTYNSNGRGGSGFFESNNNNVRGNYNNLRARDLSSSVPQYSNIFDPDDFDPDNDPDL
DVDFDTDGNAIPWTPHFPPSDPHSYDPKGSGGSPSRPGNNGPSNSDYGPDPNGPGGPDGYGGSSTYPGTSGGSGS
KPKGPGGSPSRPGNGSPSNPGYGPDPNGPGGIDGYGGSSNYPGTSGGPGSNPNTYGKPKGSGVSPSNPGRPGSVP
GNSGNNGPSSPGYGPDPNGPGGPDGYGGSGNNPGYPGSSGGNPNGPGSSPGRTRPGGPGSSPGTGGNGPSNPGYD
SDPYGPGGPNNYGGPGNNPKSPGGSGGNPKNPRPGSGGPGSSPSNPGYNNDPGYGNPGYGNPGYGDSNPNNYGNP
NSGSPNGPGDNPYNPGSGPRGPGSSPGNPGYGGGTGSSPNPDYGNSSPTGPGGFPGNSGNPVALAATPIYRALDL
EDPAAHLAIQDTATLQGIPTVKEAQDLEDLITSLVTPVTATLQGIPTVQEAQDLEDLAVSLATPVTATLQAIPTA
QEAQDLEGRVANRATLGTAVPEILGTEIRTAQEALDPGDLAVNPTTQDTATLRVTPTAQEARGLEDRAANQATLD
TTVPVIQDTETRTVQEVLPPEDLANNLTTLDTTVPVIQVTETRTVQEVLVPEDLAANQATLDTTVPVIQDTETRT
VQEALPPEDLADNLTTLDTTTPATQDTETRTVQEVPAPEDLADNLATRDTATRTPMAQEVPATEDLAAHLTILDT
TTLATQVTETRTAQGVPIPTGVPATLGTTGPAIQDTETQVVQEVPMDMKAATLDLLAATPTAQEVLLESPDLLEL
AARQATQDIAMGLATLETTDLTARLTARGTVADLTTRLMARGTAVGLTARLIAQHTAMGQTARDTVTGLTTRLTA
HGTAADLTARLMARGTAVDLTDRLIARYTAMAQTTRDTAADLGTHLTTPVTDREIQDTTDRGARLTLRDTVTGLE
AREYGNGSPGDGVGPSNPGYGDGPGSPGYGNEPGGPPSNPGSGGSSPGSGSPGNTGPSSPPDNPGYGDGPGNPPS
NPGYGDGPNSPPSNPGYGGSNPGSGSPSNGGPGNPPSNPGYGDGPGNPPTNPPSNPGYSDGPGNPPNKPGYGDGP
SNPPNNPGYSDGPGNPPSNPPSNPGYGDGPDTPPSNPGYGEGPNISPDDPGYGDTDPGYGESNPDGSDNPNGPPD
GPPDGPPDGPPDGPLMAPLMVLLMVLLMVLLMVRLKIRDTEILAVREVRTATEVATLGPLTVLQTVLQTVLQTVL
QTVLLTVLLTVLLTVLLTALLMVRLKIRDTEILAVREVRTATEVATLGLPTILQTVLQTVLQTVPLTVPLTVPLT
ALLVILPKTPGYDPNGSEGPGYDPNGPTNPGYNPNGPGGNGPDNNPGNNPPGYNNPNNPSDPSYNPNGPAVDPNS
LADPGYGNPSYSDPSTTPGSTSSNPIKDLLDKGQSIGGKLFPEGSPLALGGTVGKTQNGGLGFDVNGGIGVPGLG
LNLGLSGAADGKKVGLNNNVGITLGDKTYGINLNNGLGNNGAGITPFSNAQAGSNPLDPGSTLGAYDPNKKGAQG
GGVDFVDQARNLKVPGGINNLLGL*
Coding >Ophcf2|01575
ATGGTGGGCCGAAAGCTATGGCTCTTTGCCCTCTGCGGCATAGACGCCGTCGTCGGCTTCTCGCAACTGGCCAGC
CTTTCACACACGCTGCAGCAGGCACTGGGCAACAGCTCCATACAAGCTGACAGCACAGCTCAGAGGACCCAAGAG
TTGCTGATGAGCAGCTCGATACAGCAAGTCTTGATGAATAGCTATGCCAACATCGAGTCTCTCAAGGCGTCGACG
GCTGAGCACTTGATGGCCGGATACGATACGCTGTGGGAGAAGCATCCGTATATCCCCCCTGGACCCAACGACTCA
CGAAGCCCCTGTCCCACTCTCAACGCCCTCGCCAACCACGGCTACTTCCGCCGCGATGGCAAGAACCTCTTTCTC
CCCGATATGCTCATCGGCCTCTTCCTCGGCGTCGGTCTCTCCCCGGAGTTGGGCGCCATCATCTTGGCCTTTGCC
ATCCTCTCAGCCGAAAAGCCCTTGACGGGTTCCATAAGTCTCCGTGATCTAGCGACGCACGAGACGGGCATCGAA
CACGATTGCAGCATGTCTCGAAAGGACCATGCCATCGGTGACGACGGCATCTTCGATCCCGAGTCCTGGGCCGTT
GCCTATCAAGAGATGAAGAAGAGTAAGATTCTGAATCCGATTCGTATGGGTCAGGCCAAAGCCGCGCGTGTCAAA
GACGCCAGGAGAGTGAATCCCAAGACCCTCTTCGGGCCCAAAGCTTGGTTCAACGGCTACGCTGAGCTGGGCCTC
ATCCTATCCGTCTTCGGCTTCTTTCCCGGCCTGGCCAAGCTCGAGGTAATCAAGACCGTCTTCGAGGAGGAGAGA
TTGCCGTATGATCTCGGCTGGCGGCCTTATCCCTTTGTTGCAAACACGCCCGTCGTTCTCGCCGTCGGCGCCATA
TCCGTCCTCGGTGATACCGACGCCTTTGGAACTTATGGCAGCGTTGTTAGCGGGGAACCAACGGAAATCCTGCAA
GTCTTCTTACCCCCTAGTCTCGACCACCTCCCCGAGCTCGAGAAGCTCATTGGCAACCTTGGCTTCAACAACGGT
CCGATGAAGCTCCTCAGCGGCGTCATGAGAAGCATCTCAAAGCAGAAGAACCCGGTGGCGGAGGAGGAGAAACTG
GTCGGAGACAAGGGCTTCCACGGTTCCGGAGCCATGCCCTTCGACGCCCCGCCCCCAGGCTCCGGTCTTCAATCC
CTGGGCGGCCAGGACAAGAGGACCGGTCTTCCCGCCGATGTAATCGGTACTCTCAAGCGTCTTCTCGGTCTGGGC
AACAAGGAACCGGGTCTGGGTTCCGGTAGTTCTGGCGGTTTGGGGGGCTTCAATCCTAGCTCTGGATCTCCTACC
AACGGCAATGGCGGCTATAATAATCTGAACAGCGGCAATGGCGTCTTTAATAATCCAAACAACGGTTACGGCGGC
TTCAACAATCCAGGAGGCTATAACAACAACGGTAATACTGGCTACAACAACCCAGGAGGCTACAACAACAACGGC
AACACTGGCTTCAACAACCCAGGAGGCTTTCGTCCAGGCTCTGGGTCTCCTGGGTATCCTTACACCGGTAATGGC
GGTTATAACAATCTAGGAAATTATCCCAACTATGGTAAAGGGGGCTACAACAGCCCGGGGGGTTATAACAACAAC
AACGGCAATAGAGGCTTTACTAACCCTAACAACGGTAACCGCGGCTTTAACAACCCATACCCTAATTACAGTTAC
GGCGGCAATAGGGACTTCAACAACCCTAACAACGGTAACCGCGGCTTTGTCAATCAAAACCCCAATTACAGCTAT
AGCGGCAACAGCGTACGAGGCACTAGTCCTAACCCTGGATCGTCTGGATACTATTTCACTTACAATTCTAATGGC
CGAGGAGGCTCTGGATTCTTTGAAAGCAACAACAACAACGTGAGAGGTAACTACAACAACCTCAGAGCCAGGGAC
CTCAGCTCCAGCGTCCCGCAATACAGCAACATCTTTGATCCAGATGATTTCGACCCTGACAACGATCCTGACCTG
GATGTTGATTTCGACACCGATGGAAATGCTATCCCTTGGACTCCACACTTCCCTCCCAGCGATCCTCACAGCTAT
GACCCCAAGGGCTCAGGAGGATCACCCAGTAGACCCGGGAACAACGGCCCAAGCAATTCCGACTACGGCCCAGAC
CCTAACGGTCCGGGAGGGCCCGATGGCTACGGAGGGTCAAGTACTTACCCCGGGACTTCGGGAGGATCTGGCAGC
AAGCCCAAGGGTCCAGGAGGATCCCCCAGTAGACCCGGGAACGGCAGCCCCAGCAATCCGGGATATGGTCCTGAC
CCCAACGGGCCAGGGGGTATCGATGGCTACGGAGGTTCGAGCAACTACCCTGGCACCTCGGGGGGTCCTGGTAGT
AATCCCAACACTTATGGCAAGCCCAAAGGATCAGGGGTATCTCCCAGCAATCCTGGGCGACCTGGCAGTGTGCCT
GGAAACTCTGGAAACAACGGCCCCAGCAGTCCGGGATACGGTCCTGACCCCAACGGCCCAGGAGGTCCCGATGGC
TATGGAGGTTCAGGCAACAACCCCGGTTACCCAGGCAGTTCTGGCGGAAACCCCAACGGCCCGGGAAGCTCTCCA
GGTAGGACCAGACCTGGAGGGCCCGGTAGCTCGCCGGGAACTGGGGGCAATGGTCCTAGCAATCCGGGGTACGAC
TCAGATCCGTACGGCCCGGGAGGTCCCAATAACTACGGAGGTCCGGGTAATAATCCCAAGTCTCCGGGCGGCTCT
GGCGGTAACCCTAAGAACCCGAGACCTGGATCTGGAGGACCCGGTAGCTCGCCTAGCAACCCTGGGTATAACAAC
GACCCAGGGTACGGCAACCCAGGGTACGGCAACCCAGGGTACGGCGACTCTAACCCCAACAACTACGGGAATCCA
AACTCCGGATCTCCGAATGGTCCCGGCGACAACCCTTATAACCCAGGCTCCGGACCCAGAGGACCTGGCAGCTCA
CCTGGCAACCCGGGATACGGCGGGGGAACTGGAAGCTCACCCAACCCAGATTACGGCAACTCCAGTCCCACCGGT
CCAGGAGGCTTCCCTGGAAACTCTGGAAATCCTGTGGCCCTGGCCGCAACCCCAATATACCGGGCTCTGGACCTA
GAGGACCCGGCAGCTCACCTAGCAATCCAGGATACGGCAACCCTACAGGGAATCCCAACGGTCAAGGAGGCTCAA
GACCTGGAGGACCTGATAACCAGCCTAGTAACCCCGGTTACGGCAACCCTACAGGGAATCCCAACGGTCCAGGAG
GCTCAAGACCTGGAGGATCTAGCAGTCAGCCTAGCAACCCCGGTTACGGCAACCCTACAGGCAATCCCAACGGCC
CAGGAGGCTCAAGACCTGGAGGGCCGGGTAGCCAACCGAGCGACCCTGGGTACGGCGGTCCCAGAAATCCTGGGT
ACGGAGATTCGAACGGCCCAGGAAGCTCTAGACCCGGGGGATCTGGCAGTCAACCCAACAACCCAGGATACGGCA
ACCCTACGAGTAACCCCAACGGCCCAGGAGGCTCGAGGCCTGGAGGACCGGGCAGCCAACCAAGCAACCCTGGAT
ACAACGGTCCCAGTAATCCAGGATACGGAGACTCGAACGGTCCAGGAGGTTCTACCCCCGGAGGACCTGGCAAAC
AACCTAACAACCCTGGATACAACGGTCCCAGTAATCCAGGTTACGGAGACCCGAACGGTCCAGGAGGTTCTGGTC
CCGGAGGACCTGGCAGCCAACCAAGCAACCCTGGATACAACGGTCCCAGTAATCCAGGATACGGAGACTCGAACG
GTCCAGGAGGCTCTACCCCCGGAGGACCTAGCAGACAACCTAACAACCCTGGATACAACAACCCCAGCAACCCAG
GATACGGAGACTCGAACGGTCCAGGAGGTTCCGGCCCCGGAGGACCTGGCAGACAACCTAGCAACCCGGGATACG
GCAACTCGAACCCCGATGGCCCAGGAGGTCCCAGCTACGGAGGACCTGGCAGCTCACCTAACAATCCTGGATACA
ACAACCCTAGCAACCCAGGTTACGGAGACTCGAACGGCCCAGGGGGTCCCGATACCTACGGGGGTCCCGGCAACT
CTGGGAACAACGGGCCCAGCAATCCAGGATACGGAGACACAAGTGGTCCAGGAGGTCCCAATGGATATGAAGGCG
GCAACTCTGGATCTCCTGGCGGCAACCCCAACAGCCCAGGAGGTCCTTCTGGAAAGCCCGGATCTTCTGGAACTG
GCAGCTCGCCAAGCAACCCAGGATATAGCGATGGGCCTGGCAACCCTGGAAACGACGGACCTGACAGCTCGTCTG
ACGGCCCGTGGTACGGTGGCGGATCTAACAACTCGCCTGATGGCCCGTGGTACGGCGGTGGGTCTGACGGCTCGC
CTGATAGCCCAGCATACGGCGATGGGCCAGACAGCCCGGGATACGGTAACGGGCCTAACGACTCGCCTGACGGCC
CATGGTACGGCGGCGGATCTAACAGCTCGCCTGATGGCCCGTGGTACGGCGGTGGATCTGACGGATCGCCTGATA
GCCCGGTATACGGCGATGGCTCAGACAACCCGGGATACGGCGGCGGACCTGGGAACTCACCTGACAACCCCGGTG
ACGGACCGGGAAATCCAGGATACAACGGACCGGGGAGCTCGTCTGACGCTCCGGGATACGGTGACGGGCCTGGAA
GCCCGGGAATACGGTAACGGCAGTCCGGGAGACGGCGTCGGACCTAGCAATCCGGGATACGGCGACGGACCTGGC
AGTCCGGGTTACGGCAACGAACCCGGGGGTCCACCTAGCAACCCGGGATCCGGCGGCTCATCTCCAGGCTCTGGA
TCCCCAGGCAATACAGGACCTAGCAGCCCCCCAGACAACCCGGGATACGGTGACGGACCGGGCAACCCACCGAGT
AATCCAGGATACGGCGATGGGCCTAACAGTCCGCCCAGTAACCCAGGATACGGCGGCTCGAATCCCGGCTCCGGG
TCTCCGAGTAATGGAGGTCCCGGTAACCCGCCGAGCAATCCGGGATACGGAGACGGACCTGGCAACCCGCCGACT
AACCCGCCGAGCAACCCGGGATATAGCGATGGACCTGGCAACCCTCCGAACAAGCCAGGATACGGTGACGGACCT
AGCAACCCGCCGAACAACCCAGGGTACAGCGATGGGCCTGGGAATCCGCCCAGCAATCCGCCCAGCAACCCAGGC
TACGGCGACGGACCAGATACTCCGCCCAGCAACCCGGGATATGGTGAAGGACCTAACATTTCCCCGGACGACCCG
GGATACGGTGACACTGACCCCGGCTACGGGGAGTCTAACCCTGACGGTTCCGACAATCCTAACGGTCCCCCTGAT
GGTCCCCCTGATGGTCCCCCTGATGGTCCCCCTGATGGCCCCCTGATGGCCCCCCTGATGGTCCTCCTGATGGTC
CTCCTGATGGTCCTCCTGATGGTCCGCCTGAAAATCCGGGATACGGAGATCCTAGCGGTCCGGGAGGTTCGGACG
GCTACGGAGGTAGCGACTCTGGGTCCCTTAACGGTCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCTC
CAGACGGTCCTCCTAACGGTCCTCCTGACGGTCCTCCTGACGGTCCTCCTGACGGCCCTCCTGATGGTCCGCCTG
AAAATCCGGGATACGGAGATCCTAGCGGTCCGGGAGGTCCGGACGGCTACGGAGGTAGCGACTCTGGGTCTCCCA
ACGATCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCCCCTGACGGTCCCCCTGACGGTCCCCCTGACG
GCCCTCCTAGTAATCCTCCCGAAAACTCCGGGTTACGACCCCAACGGCTCAGAAGGACCAGGTTACGACCCCAAT
GGCCCGACAAACCCGGGCTACAACCCGAACGGCCCGGGAGGTAACGGCCCCGACAACAACCCCGGCAACAACCCG
CCCGGCTACAACAACCCCAACAACCCATCAGACCCAAGCTACAACCCCAACGGCCCAGCAGTCGACCCCAACAGC
CTGGCAGACCCAGGCTACGGCAACCCCAGCTATAGCGACCCCAGCACCACCCCCGGCAGCACGTCCAGCAACCCG
ATCAAGGACCTCCTCGACAAGGGTCAATCCATCGGCGGCAAACTCTTCCCCGAAGGCTCACCCTTGGCCCTGGGC
GGCACGGTGGGAAAAACACAAAACGGCGGGTTGGGCTTCGACGTCAACGGCGGCATCGGCGTCCCCGGCCTGGGC
CTTAACCTCGGTCTATCGGGCGCTGCCGACGGTAAGAAGGTGGGCTTGAATAACAACGTCGGCATCACGTTGGGA
GACAAGACGTACGGCATCAACTTGAACAACGGGCTCGGCAACAACGGCGCCGGAATCACTCCCTTCTCCAACGCC
CAGGCTGGCTCCAACCCTCTCGACCCCGGCTCGACTCTTGGCGCCTACGACCCTAACAAGAAGGGGGCCCAGGGC
GGAGGCGTGGACTTTGTGGACCAGGCTCGGAACTTGAAGGTGCCGGGGGGTATCAACAACCTTCTTGGGTTGTAA
Transcript >Ophcf2|01575
ATGGTGGGCCGAAAGCTATGGCTCTTTGCCCTCTGCGGCATAGACGCCGTCGTCGGCTTCTCGCAACTGGCCAGC
CTTTCACACACGCTGCAGCAGGCACTGGGCAACAGCTCCATACAAGCTGACAGCACAGCTCAGAGGACCCAAGAG
TTGCTGATGAGCAGCTCGATACAGCAAGTCTTGATGAATAGCTATGCCAACATCGAGTCTCTCAAGGCGTCGACG
GCTGAGCACTTGATGGCCGGATACGATACGCTGTGGGAGAAGCATCCGTATATCCCCCCTGGACCCAACGACTCA
CGAAGCCCCTGTCCCACTCTCAACGCCCTCGCCAACCACGGCTACTTCCGCCGCGATGGCAAGAACCTCTTTCTC
CCCGATATGCTCATCGGCCTCTTCCTCGGCGTCGGTCTCTCCCCGGAGTTGGGCGCCATCATCTTGGCCTTTGCC
ATCCTCTCAGCCGAAAAGCCCTTGACGGGTTCCATAAGTCTCCGTGATCTAGCGACGCACGAGACGGGCATCGAA
CACGATTGCAGCATGTCTCGAAAGGACCATGCCATCGGTGACGACGGCATCTTCGATCCCGAGTCCTGGGCCGTT
GCCTATCAAGAGATGAAGAAGAGTAAGATTCTGAATCCGATTCGTATGGGTCAGGCCAAAGCCGCGCGTGTCAAA
GACGCCAGGAGAGTGAATCCCAAGACCCTCTTCGGGCCCAAAGCTTGGTTCAACGGCTACGCTGAGCTGGGCCTC
ATCCTATCCGTCTTCGGCTTCTTTCCCGGCCTGGCCAAGCTCGAGGTAATCAAGACCGTCTTCGAGGAGGAGAGA
TTGCCGTATGATCTCGGCTGGCGGCCTTATCCCTTTGTTGCAAACACGCCCGTCGTTCTCGCCGTCGGCGCCATA
TCCGTCCTCGGTGATACCGACGCCTTTGGAACTTATGGCAGCGTTGTTAGCGGGGAACCAACGGAAATCCTGCAA
GTCTTCTTACCCCCTAGTCTCGACCACCTCCCCGAGCTCGAGAAGCTCATTGGCAACCTTGGCTTCAACAACGGT
CCGATGAAGCTCCTCAGCGGCGTCATGAGAAGCATCTCAAAGCAGAAGAACCCGGTGGCGGAGGAGGAGAAACTG
GTCGGAGACAAGGGCTTCCACGGTTCCGGAGCCATGCCCTTCGACGCCCCGCCCCCAGGCTCCGGTCTTCAATCC
CTGGGCGGCCAGGACAAGAGGACCGGTCTTCCCGCCGATGTAATCGGTACTCTCAAGCGTCTTCTCGGTCTGGGC
AACAAGGAACCGGGTCTGGGTTCCGGTAGTTCTGGCGGTTTGGGGGGCTTCAATCCTAGCTCTGGATCTCCTACC
AACGGCAATGGCGGCTATAATAATCTGAACAGCGGCAATGGCGTCTTTAATAATCCAAACAACGGTTACGGCGGC
TTCAACAATCCAGGAGGCTATAACAACAACGGTAATACTGGCTACAACAACCCAGGAGGCTACAACAACAACGGC
AACACTGGCTTCAACAACCCAGGAGGCTTTCGTCCAGGCTCTGGGTCTCCTGGGTATCCTTACACCGGTAATGGC
GGTTATAACAATCTAGGAAATTATCCCAACTATGGTAAAGGGGGCTACAACAGCCCGGGGGGTTATAACAACAAC
AACGGCAATAGAGGCTTTACTAACCCTAACAACGGTAACCGCGGCTTTAACAACCCATACCCTAATTACAGTTAC
GGCGGCAATAGGGACTTCAACAACCCTAACAACGGTAACCGCGGCTTTGTCAATCAAAACCCCAATTACAGCTAT
AGCGGCAACAGCGTACGAGGCACTAGTCCTAACCCTGGATCGTCTGGATACTATTTCACTTACAATTCTAATGGC
CGAGGAGGCTCTGGATTCTTTGAAAGCAACAACAACAACGTGAGAGGTAACTACAACAACCTCAGAGCCAGGGAC
CTCAGCTCCAGCGTCCCGCAATACAGCAACATCTTTGATCCAGATGATTTCGACCCTGACAACGATCCTGACCTG
GATGTTGATTTCGACACCGATGGAAATGCTATCCCTTGGACTCCACACTTCCCTCCCAGCGATCCTCACAGCTAT
GACCCCAAGGGCTCAGGAGGATCACCCAGTAGACCCGGGAACAACGGCCCAAGCAATTCCGACTACGGCCCAGAC
CCTAACGGTCCGGGAGGGCCCGATGGCTACGGAGGGTCAAGTACTTACCCCGGGACTTCGGGAGGATCTGGCAGC
AAGCCCAAGGGTCCAGGAGGATCCCCCAGTAGACCCGGGAACGGCAGCCCCAGCAATCCGGGATATGGTCCTGAC
CCCAACGGGCCAGGGGGTATCGATGGCTACGGAGGTTCGAGCAACTACCCTGGCACCTCGGGGGGTCCTGGTAGT
AATCCCAACACTTATGGCAAGCCCAAAGGATCAGGGGTATCTCCCAGCAATCCTGGGCGACCTGGCAGTGTGCCT
GGAAACTCTGGAAACAACGGCCCCAGCAGTCCGGGATACGGTCCTGACCCCAACGGCCCAGGAGGTCCCGATGGC
TATGGAGGTTCAGGCAACAACCCCGGTTACCCAGGCAGTTCTGGCGGAAACCCCAACGGCCCGGGAAGCTCTCCA
GGTAGGACCAGACCTGGAGGGCCCGGTAGCTCGCCGGGAACTGGGGGCAATGGTCCTAGCAATCCGGGGTACGAC
TCAGATCCGTACGGCCCGGGAGGTCCCAATAACTACGGAGGTCCGGGTAATAATCCCAAGTCTCCGGGCGGCTCT
GGCGGTAACCCTAAGAACCCGAGACCTGGATCTGGAGGACCCGGTAGCTCGCCTAGCAACCCTGGGTATAACAAC
GACCCAGGGTACGGCAACCCAGGGTACGGCAACCCAGGGTACGGCGACTCTAACCCCAACAACTACGGGAATCCA
AACTCCGGATCTCCGAATGGTCCCGGCGACAACCCTTATAACCCAGGCTCCGGACCCAGAGGACCTGGCAGCTCA
CCTGGCAACCCGGGATACGGCGGGGGAACTGGAAGCTCACCCAACCCAGATTACGGCAACTCCAGTCCCACCGGT
CCAGGAGGCTTCCCTGGAAACTCTGGAAATCCTGTGGCCCTGGCCGCAACCCCAATATACCGGGCTCTGGACCTA
GAGGACCCGGCAGCTCACCTAGCAATCCAGGATACGGCAACCCTACAGGGAATCCCAACGGTCAAGGAGGCTCAA
GACCTGGAGGACCTGATAACCAGCCTAGTAACCCCGGTTACGGCAACCCTACAGGGAATCCCAACGGTCCAGGAG
GCTCAAGACCTGGAGGATCTAGCAGTCAGCCTAGCAACCCCGGTTACGGCAACCCTACAGGCAATCCCAACGGCC
CAGGAGGCTCAAGACCTGGAGGGCCGGGTAGCCAACCGAGCGACCCTGGGTACGGCGGTCCCAGAAATCCTGGGT
ACGGAGATTCGAACGGCCCAGGAAGCTCTAGACCCGGGGGATCTGGCAGTCAACCCAACAACCCAGGATACGGCA
ACCCTACGAGTAACCCCAACGGCCCAGGAGGCTCGAGGCCTGGAGGACCGGGCAGCCAACCAAGCAACCCTGGAT
ACAACGGTCCCAGTAATCCAGGATACGGAGACTCGAACGGTCCAGGAGGTTCTACCCCCGGAGGACCTGGCAAAC
AACCTAACAACCCTGGATACAACGGTCCCAGTAATCCAGGTTACGGAGACCCGAACGGTCCAGGAGGTTCTGGTC
CCGGAGGACCTGGCAGCCAACCAAGCAACCCTGGATACAACGGTCCCAGTAATCCAGGATACGGAGACTCGAACG
GTCCAGGAGGCTCTACCCCCGGAGGACCTAGCAGACAACCTAACAACCCTGGATACAACAACCCCAGCAACCCAG
GATACGGAGACTCGAACGGTCCAGGAGGTTCCGGCCCCGGAGGACCTGGCAGACAACCTAGCAACCCGGGATACG
GCAACTCGAACCCCGATGGCCCAGGAGGTCCCAGCTACGGAGGACCTGGCAGCTCACCTAACAATCCTGGATACA
ACAACCCTAGCAACCCAGGTTACGGAGACTCGAACGGCCCAGGGGGTCCCGATACCTACGGGGGTCCCGGCAACT
CTGGGAACAACGGGCCCAGCAATCCAGGATACGGAGACACAAGTGGTCCAGGAGGTCCCAATGGATATGAAGGCG
GCAACTCTGGATCTCCTGGCGGCAACCCCAACAGCCCAGGAGGTCCTTCTGGAAAGCCCGGATCTTCTGGAACTG
GCAGCTCGCCAAGCAACCCAGGATATAGCGATGGGCCTGGCAACCCTGGAAACGACGGACCTGACAGCTCGTCTG
ACGGCCCGTGGTACGGTGGCGGATCTAACAACTCGCCTGATGGCCCGTGGTACGGCGGTGGGTCTGACGGCTCGC
CTGATAGCCCAGCATACGGCGATGGGCCAGACAGCCCGGGATACGGTAACGGGCCTAACGACTCGCCTGACGGCC
CATGGTACGGCGGCGGATCTAACAGCTCGCCTGATGGCCCGTGGTACGGCGGTGGATCTGACGGATCGCCTGATA
GCCCGGTATACGGCGATGGCTCAGACAACCCGGGATACGGCGGCGGACCTGGGAACTCACCTGACAACCCCGGTG
ACGGACCGGGAAATCCAGGATACAACGGACCGGGGAGCTCGTCTGACGCTCCGGGATACGGTGACGGGCCTGGAA
GCCCGGGAATACGGTAACGGCAGTCCGGGAGACGGCGTCGGACCTAGCAATCCGGGATACGGCGACGGACCTGGC
AGTCCGGGTTACGGCAACGAACCCGGGGGTCCACCTAGCAACCCGGGATCCGGCGGCTCATCTCCAGGCTCTGGA
TCCCCAGGCAATACAGGACCTAGCAGCCCCCCAGACAACCCGGGATACGGTGACGGACCGGGCAACCCACCGAGT
AATCCAGGATACGGCGATGGGCCTAACAGTCCGCCCAGTAACCCAGGATACGGCGGCTCGAATCCCGGCTCCGGG
TCTCCGAGTAATGGAGGTCCCGGTAACCCGCCGAGCAATCCGGGATACGGAGACGGACCTGGCAACCCGCCGACT
AACCCGCCGAGCAACCCGGGATATAGCGATGGACCTGGCAACCCTCCGAACAAGCCAGGATACGGTGACGGACCT
AGCAACCCGCCGAACAACCCAGGGTACAGCGATGGGCCTGGGAATCCGCCCAGCAATCCGCCCAGCAACCCAGGC
TACGGCGACGGACCAGATACTCCGCCCAGCAACCCGGGATATGGTGAAGGACCTAACATTTCCCCGGACGACCCG
GGATACGGTGACACTGACCCCGGCTACGGGGAGTCTAACCCTGACGGTTCCGACAATCCTAACGGTCCCCCTGAT
GGTCCCCCTGATGGTCCCCCTGATGGTCCCCCTGATGGCCCCCTGATGGCCCCCCTGATGGTCCTCCTGATGGTC
CTCCTGATGGTCCTCCTGATGGTCCGCCTGAAAATCCGGGATACGGAGATCCTAGCGGTCCGGGAGGTTCGGACG
GCTACGGAGGTAGCGACTCTGGGTCCCTTAACGGTCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCTC
CAGACGGTCCTCCTAACGGTCCTCCTGACGGTCCTCCTGACGGTCCTCCTGACGGCCCTCCTGATGGTCCGCCTG
AAAATCCGGGATACGGAGATCCTAGCGGTCCGGGAGGTCCGGACGGCTACGGAGGTAGCGACTCTGGGTCTCCCA
ACGATCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCCCCTGACGGTCCCCCTGACGGTCCCCCTGACG
GCCCTCCTAGTAATCCTCCCGAAAACTCCGGGTTACGACCCCAACGGCTCAGAAGGACCAGGTTACGACCCCAAT
GGCCCGACAAACCCGGGCTACAACCCGAACGGCCCGGGAGGTAACGGCCCCGACAACAACCCCGGCAACAACCCG
CCCGGCTACAACAACCCCAACAACCCATCAGACCCAAGCTACAACCCCAACGGCCCAGCAGTCGACCCCAACAGC
CTGGCAGACCCAGGCTACGGCAACCCCAGCTATAGCGACCCCAGCACCACCCCCGGCAGCACGTCCAGCAACCCG
ATCAAGGACCTCCTCGACAAGGGTCAATCCATCGGCGGCAAACTCTTCCCCGAAGGCTCACCCTTGGCCCTGGGC
GGCACGGTGGGAAAAACACAAAACGGCGGGTTGGGCTTCGACGTCAACGGCGGCATCGGCGTCCCCGGCCTGGGC
CTTAACCTCGGTCTATCGGGCGCTGCCGACGGTAAGAAGGTGGGCTTGAATAACAACGTCGGCATCACGTTGGGA
GACAAGACGTACGGCATCAACTTGAACAACGGGCTCGGCAACAACGGCGCCGGAATCACTCCCTTCTCCAACGCC
CAGGCTGGCTCCAACCCTCTCGACCCCGGCTCGACTCTTGGCGCCTACGACCCTAACAAGAAGGGGGCCCAGGGC
GGAGGCGTGGACTTTGTGGACCAGGCTCGGAACTTGAAGGTGCCGGGGGGTATCAACAACCTTCTTGGGTTGTAA
Gene >Ophcf2|01575
ATGGTGGGCCGAAAGCTATGGCTCTTTGCCCTCTGCGGCATAGACGCCGTCGTCGGCTTCTCGCAACTGGCCAGC
CTTTCACACACGCTGCAGCAGGCACTGGGCAACAGCTCCATACAAGCTGACAGCACAGCTCAGAGGACCCAAGAG
TTGCTGATGAGCAGCTCGATACAGCAAGTCTTGATGAATAGCTATGCCAACATCGAGTCTCTCAAGGCGTCGACG
GCTGAGCACTTGATGGCCGGATACGATACGCTGTGGGAGAAGCATCCGTATATCCCCCCTGGACCCAACGACTGT
TAGCCATACCGTTCTTCCCCATCCATTCAGTTCTAAGAGAAGATAGCTGACTGGAAGACTCACAGCACGAAGCCC
CTGTCCCACTCTCAACGCCCTCGCCAACCACGGCTACTTCCGCCGCGATGGCAAGAACCTCTTTCTCCCCGATAT
GCTCATCGGCCTCTTCCTCGGCGTCGGTCTCTCCCCGGAGTTGGGCGCCATCATCTTGGCCTTTGCCATCCTCTC
AGCCGAAAAGCCCTTGACGGGTTCCATAAGTCTCCGTGATCTAGCGACGCACGAGACGGGCATCGAACACGATTG
CAGCATGTCTCGAAAGGACCATGCCATCGGTGACGACGGCATCTTCGATCCCGAGTCCTGGGCCGTTGCCTATCA
AGAGATGAAGAAGAGTAAGATTCTGAATCCGATTCGTATGGGTCAGGCCAAAGCCGCGCGTGTCAAAGACGCCAG
GAGAGTGAATCCCAAGACCCTCTTCGGGCCCAAAGCTTGGTTCAACGGCTACGCTGAGCTGGGCCTCATCCTATC
CGTCTTCGGCTTCTTTCCCGGCCTGGCCAAGCTCGAGGTAATCAAGACCGTCTTCGAGGAGGAGAGATTGCCGTA
TGATCTCGGCTGGCGGCCTTATCCCTTTGTTGCAAACACGCCCGTCGTTCTCGCCGTCGGCGCCATATCCGTCCT
CGGTGATACCGACGCCTTTGGAACTTATGGCAGCGTTGTTAGCGGGGAACCAACGGTAAGTCTTCAATGCCCTCT
TGGAAAGACGAGACTGACGTCGTGTCTTGAAAGGAAATCCTGCAAGTCTTCTTACCCCCTAGTCTCGACCACCTC
CCCGAGCTCGAGAAGCTCATTGGCAACCTTGGCTTCAACAACGGTCCGATGAAGCTCCTCAGCGGCGTCATGAGA
AGCATCTCAAAGCAGAAGAACCCGGTGGCGGAGGAGGAGAAACTGGTCGGAGACAAGGGCTTCCACGGTTCCGGA
GCCATGCCCTTCGACGCCCCGCCCCCAGGCTCCGGTCTTCAATCCCTGGGCGGCCAGGACAAGAGGACCGGTCTT
CCCGCCGATGTAATCGGTACTCTCAAGCGTCTTCTCGGTCTGGGCAACAAGGAACCGGGTGTGAGCTCCGGAGGA
GGGAAAAAGCTTAGCTCGAACTTGGCTAGCTTGCTTAAAATTCCAGGTCTGGGTTCCGGTAGTTCTGGCGGTTTG
GGGGGCTTCAATCCTAGCTCTGGATCTCCTACCAACGGCAATGGCGGCTATAATAATCTGAACAGCGGCAATGGC
GTCTTTAATAATCCAAACAACGGTTACGGCGGCTTCAACAATCCAGGAGGCTATAACAACAACGGTAATACTGGC
TACAACAACCCAGGAGGCTACAACAACAACGGCAACACTGGCTTCAACAACCCAGGAGGCTTTCGTCCAGGCTCT
GGGTCTCCTGGGTATCCTTACACCGGTAATGGCGGTTATAACAATCTAGGAAATTATCCCAACTATGGTAAAGGG
GGCTACAACAGCCCGGGGGGTTATAACAACAACAACGGCAATAGAGGCTTTACTAACCCTAACAACGGTAACCGC
GGCTTTAACAACCCATACCCTAATTACAGTTACGGCGGCAATAGGGACTTCAACAACCCTAACAACGGTAACCGC
GGCTTTGTCAATCAAAACCCCAATTACAGCTATAGCGGCAACAGCGTACGAGGCACTAGTCCTAACCCTGGATCG
TCTGGATACTATTTCACTTACAATTCTAATGGCCGAGGAGGCTCTGGATTCTTTGAAAGCAACAACAACAACGTG
AGAGGTAACTACAACAACCTCAGAGCCAGGGACCTCAGCTCCAGCGTCCCGCAATACAGCAACATCTTTGATCCA
GATGATTTCGACCCTGACAACGATCCTGACCTGGATGTTGATTTCGACACCGATGGAAATGCTATCCCTTGGACT
CCACACTTCCCTCCCAGCGATCCTCACAGCTATGACCCCAAGGGCTCAGGAGGATCACCCAGTAGACCCGGGAAC
AACGGCCCAAGCAATTCCGACTACGGCCCAGACCCTAACGGTCCGGGAGGGCCCGATGGCTACGGAGGGTCAAGT
ACTTACCCCGGGACTTCGGGAGGATCTGGCAGCAAGCCCAAGGGTCCAGGAGGATCCCCCAGTAGACCCGGGAAC
GGCAGCCCCAGCAATCCGGGATATGGTCCTGACCCCAACGGGCCAGGGGGTATCGATGGCTACGGAGGTTCGAGC
AACTACCCTGGCACCTCGGGGGGTCCTGGTAGTAATCCCAACACTTATGGCAAGCCCAAAGGATCAGGGGTATCT
CCCAGCAATCCTGGGCGACCTGGCAGTGTGCCTGGAAACTCTGGAAACAACGGCCCCAGCAGTCCGGGATACGGT
CCTGACCCCAACGGCCCAGGAGGTCCCGATGGCTATGGAGGTTCAGGCAACAACCCCGGTTACCCAGGCAGTTCT
GGCGGAAACCCCAACGGCCCGGGAAGCTCTCCAGGTAGGACCAGACCTGGAGGGCCCGGTAGCTCGCCGGGAACT
GGGGGCAATGGTCCTAGCAATCCGGGGTACGACTCAGATCCGTACGGCCCGGGAGGTCCCAATAACTACGGAGGT
CCGGGTAATAATCCCAAGTCTCCGGGCGGCTCTGGCGGTAACCCTAAGAACCCGAGACCTGGATCTGGAGGACCC
GGTAGCTCGCCTAGCAACCCTGGGTATAACAACGACCCAGGGTACGGCAACCCAGGGTACGGCAACCCAGGGTAC
GGCGACTCTAACCCCAACAACTACGGGAATCCAAACTCCGGATCTCCGAATGGTCCCGGCGACAACCCTTATAAC
CCAGGCTCCGGACCCAGAGGACCTGGCAGCTCACCTGGCAACCCGGGATACGGCGGGGGAACTGGAAGCTCACCC
AACCCAGATTACGGCAACTCCAGTCCCACCGGTCCAGGAGGCTTCCCTGGAAACTCTGGAAATCCTGGTAGCTCA
CCCAGCAACCCGGGGTATGGCAACCCAAGTTACGGCGACTCTAATCCTTACAACTACGGAAATCCAAACTCTGGA
TCCCCGAGTGGCCCTGGCCGCAACCCCAATATACCGGGCTCTGGACCTAGAGGACCCGGCAGCTCACCTAGCAAT
CCAGGATACGGCAACCCTACAGGGAATCCCAACGGTCAAGGAGGCTCAAGACCTGGAGGACCTGATAACCAGCCT
AGTAACCCCGGTTACGGCAACCCTACAGGGAATCCCAACGGTCCAGGAGGCTCAAGACCTGGAGGATCTAGCAGT
CAGCCTAGCAACCCCGGTTACGGCAACCCTACAGGCAATCCCAACGGCCCAGGAGGCTCAAGACCTGGAGGGCCG
GGTAGCCAACCGAGCGACCCTGGGTACGGCGGTCCCAGAAATCCTGGGTACGGAGATTCGAACGGCCCAGGAAGC
TCTAGACCCGGGGGATCTGGCAGTCAACCCAACAACCCAGGATACGGCAACCCTACGAGTAACCCCAACGGCCCA
GGAGGCTCGAGGCCTGGAGGACCGGGCAGCCAACCAAGCAACCCTGGATACAACGGTCCCAGTAATCCAGGATAC
GGAGACTCGAACGGTCCAGGAGGTTCTACCCCCGGAGGACCTGGCAAACAACCTAACAACCCTGGATACAACGGT
CCCAGTAATCCAGGTTACGGAGACCCGAACGGTCCAGGAGGTTCTGGTCCCGGAGGACCTGGCAGCCAACCAAGC
AACCCTGGATACAACGGTCCCAGTAATCCAGGATACGGAGACTCGAACGGTCCAGGAGGCTCTACCCCCGGAGGA
CCTAGCAGACAACCTAACAACCCTGGATACAACAACCCCAGCAACCCAGGATACGGAGACTCGAACGGTCCAGGA
GGTTCCGGCCCCGGAGGACCTGGCAGACAACCTAGCAACCCGGGATACGGCAACTCGAACCCCGATGGCCCAGGA
GGTCCCAGCTACGGAGGACCTGGCAGCTCACCTAACAATCCTGGATACAACAACCCTAGCAACCCAGGTTACGGA
GACTCGAACGGCCCAGGGGGTCCCGATACCTACGGGGGTCCCGGCAACTCTGGGAACAACGGGCCCAGCAATCCA
GGATACGGAGACACAAGTGGTCCAGGAGGTCCCAATGGATATGAAGGCGGCAACTCTGGATCTCCTGGCGGCAAC
CCCAACAGCCCAGGAGGTCCTTCTGGAAAGCCCGGATCTTCTGGAACTGGCAGCTCGCCAAGCAACCCAGGATAT
AGCGATGGGCCTGGCAACCCTGGAAACGACGGACCTGACAGCTCGTCTGACGGCCCGTGGTACGGTGGCGGATCT
AACAACTCGCCTGATGGCCCGTGGTACGGCGGTGGGTCTGACGGCTCGCCTGATAGCCCAGCATACGGCGATGGG
CCAGACAGCCCGGGATACGGTAACGGGCCTAACGACTCGCCTGACGGCCCATGGTACGGCGGCGGATCTAACAGC
TCGCCTGATGGCCCGTGGTACGGCGGTGGATCTGACGGATCGCCTGATAGCCCGGTATACGGCGATGGCTCAGAC
AACCCGGGATACGGCGGCGGACCTGGGAACTCACCTGACAACCCCGGTGACGGACCGGGAAATCCAGGATACAAC
GGACCGGGGAGCTCGTCTGACGCTCCGGGATACGGTGACGGGCCTGGAAGCCCGGGGTATGGTGACGGGCCTGGA
TCTCCGCCAAGCAACCCGGGATACGGTAACGGACCGGGCAGCCCACCTGACAACCCAGAATACGGTAACGGCAGT
CCGGGAGACGGCGTCGGACCTAGCAATCCGGGATACGGCGACGGACCTGGCAGTCCGGGTTACGGCAACGAACCC
GGGGGTCCACCTAGCAACCCGGGATCCGGCGGCTCATCTCCAGGCTCTGGATCCCCAGGCAATACAGGACCTAGC
AGCCCCCCAGACAACCCGGGATACGGTGACGGACCGGGCAACCCACCGAGTAATCCAGGATACGGCGATGGGCCT
AACAGTCCGCCCAGTAACCCAGGATACGGCGGCTCGAATCCCGGCTCCGGGTCTCCGAGTAATGGAGGTCCCGGT
AACCCGCCGAGCAATCCGGGATACGGAGACGGACCTGGCAACCCGCCGACTAACCCGCCGAGCAACCCGGGATAT
AGCGATGGACCTGGCAACCCTCCGAACAAGCCAGGATACGGTGACGGACCTAGCAACCCGCCGAACAACCCAGGG
TACAGCGATGGGCCTGGGAATCCGCCCAGCAATCCGCCCAGCAACCCAGGCTACGGCGACGGACCAGATACTCCG
CCCAGCAACCCGGGATATGGTGAAGGACCTAACATTTCCCCGGACGACCCGGGATACGGTGACACTGACCCCGGC
TACGGGGAGTCTAACCCTGACGGTTCCGACAATCCTAACGGTCCCCCTGATGGTCCCCCTGATGGTCCCCCTGAT
GGTCCCCCTGATGGCCCCCTGATGGCCCCCCTGATGGTCCTCCTGATGGTCCTCCTGATGGTCCTCCTGATGGTC
CGCCTGAAAATCCGGGATACGGAGATCCTAGCGGTCCGGGAGGTTCGGACGGCTACGGAGGTAGCGACTCTGGGT
CCCTTAACGGTCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCTCCAGACGGTCCTCCTAACGGTCCTC
CTGACGGTCCTCCTGACGGTCCTCCTGACGGCCCTCCTGATGGTCCGCCTGAAAATCCGGGATACGGAGATCCTA
GCGGTCCGGGAGGTCCGGACGGCTACGGAGGTAGCGACTCTGGGTCTCCCAACGATCCTCCAGACGGTCCTCCAG
ACGGTCCTCCAGACGGTCCCCCTGACGGTCCCCCTGACGGTCCCCCTGACGGCCCTCCTAGTAATCCTCCCGAAA
ACTCCGGGTACGGAGATCCCAACGGTCCGGGAGGCCCAGACGGCTACGGAGGTAACCCCTCTGGTTCTCCCAACG
ATCCTGGCAACAACCCTTCTAGCTACAACAATCCCAAAGACCCAGATGGACCAGGTTACGACCCCAACGGCTCAG
AAGGACCAGGTTACGACCCCAATGGCCCGACAAACCCGGGCTACAACCCGAACGGCCCGGGAGGTAACGGCCCCG
ACAACAACCCCGGCAACAACCCGCCCGGCTACAACAACCCCAACAACCCATCAGACCCAAGCTACAACCCCAACG
GCCCAGCAGTCGACCCCAACAGCCTGGCAGACCCAGGCTACGGCAACCCCAGCTATAGCGACCCCAGCACCACCC
CCGGCAGCACGTCCAGCAACCCGATCAAGGACCTCCTCGACAAGGGTCAATCCATCGGCGGCAAACTCTTCCCCG
AAGGCTCACCCTTGGCCCTGGGCGGCACGGTGGGAAAAACACAAAACGGCGGGTTGGGCTTCGACGTCAACGGCG
GCATCGGCGTCCCCGGCCTGGGCCTTAACCTCGGTCTATCGGGCGCTGCCGACGGTAAGAAGGTGGGCTTGAATA
ACAACGTCGGCATCACGTTGGGAGACAAGACGTACGGCATCAACTTGAACAACGGGCTCGGCAACAACGGCGCCG
GAATCACTCCCTTCTCCAACGCCCAGGCTGGCTCCAACCCTCTCGACCCCGGCTCGACTCTTGGCGCCTACGACC
CTAACAAGAAGGGGGCCCAGGGCGGAGGCGTGGACTTTGTGGACCAGGCTCGGAACTTGAAGGTGCCGGGGGGTA
TCAACAACCTTCTTGGGTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail