Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01572
Gene name
Locationscaffold_01:5366649..5368961
Strand+
Gene length (bp)2312
Transcript length (bp)2253
Coding sequence length (bp)2253
Protein length (aa) 751

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04515 Choline_transpo Plasma-membrane choline transporter 9.3E-32 397 721

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 281 303 22
2 323 345 22
3 352 374 22
4 389 408 19
5 435 457 22
6 477 499 22
7 644 666 22
8 681 703 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01572
MFSEYASRFLAQSQSRLSNLGQPEGDHPSRPAGDWPSSRPSRRERASQPTRTILSRGNPYQQNGTGSRFGHLGFA
SRISAAQDAPLFHSTLDEFREEDDEEEEREREAADLFALQRSRRVAAASKLAESAESAVSHGSEGATAADNRPHE
YSGIKSSWNGARSRHGNRRPSYGALMEDGEDDEDDGGKGKMVDIGLESQEDGDGGDPPESLLGGEVSGDDHDQPP
STPPFRSLQPAVSEREPFISKRSSIDSEEPGSVGPRESEAGNATPTVEGELFRHDPFFAWIFLISLGGMMSTFIL
VWLHTSPRKSPVGDTIYTTLQKSFDMLAIDTVVSIMVSLVWLAALRSFVRPLVSVILVAVPVIMLSFSLYSFVSS
FQGRTGGASAQDTVMRWASLIPAGACVLWLWLVVKGRRAIQQAIEMLQFSSKILAQNPGLLAVGFGSLALIVLWT
WAWLAMFTRVFMGGYFSQSLVRFVIRLSSWWLGAAFILMYLWTLAVINAIHRATTAATVSQWYFHRNAGPTTASR
DIVTAALSHATTTMFGSICQSTLLALLLRAPLLFLPRRAGTALANLAAFWVPTPMMALTNPLTVTYSAIHSQGLV
TSARGLDRMDVVSPTLATTTLTPRALRARGGTASGLLPYRLAKLLLVATRFAMATGLGFAGWIMTAKQLQIQLPD
GMGVRGSAYAYVVGIMASFIGYSVMGAMEGILSGIVDAVLICYGSERRMERGQGRFCLEAAYLFGEGRAGEGGYV
*
Coding >Ophcf2|01572
ATGTTTTCGGAGTATGCCTCACGCTTTCTAGCACAGTCACAGTCCCGGCTGTCCAACTTGGGTCAGCCCGAAGGC
GATCACCCGTCGCGACCGGCCGGCGACTGGCCTTCGTCGAGACCCAGTCGTAGAGAGCGAGCGAGCCAGCCGACG
AGGACGATTCTCTCGCGCGGGAATCCCTACCAGCAGAATGGCACTGGGTCGCGCTTCGGTCACTTGGGGTTCGCC
TCGCGTATCTCTGCAGCTCAGGACGCGCCGCTCTTTCACAGCACCTTGGATGAGTTTCGCGAGGAGGATGATGAG
GAGGAGGAGCGGGAGCGTGAGGCTGCCGATTTGTTCGCGCTGCAGCGTTCTAGGCGCGTCGCTGCTGCTAGCAAG
CTCGCCGAGAGTGCCGAGTCGGCTGTCAGCCACGGCTCTGAAGGCGCCACCGCCGCAGACAATCGCCCTCACGAA
TACTCCGGCATCAAGAGTAGCTGGAACGGGGCGCGCAGCAGACATGGGAATCGCCGCCCGTCGTACGGTGCCCTG
ATGGAGGACGGCGAGGATGACGAGGATGATGGTGGAAAGGGAAAGATGGTCGATATCGGGCTGGAGTCCCAGGAG
GATGGCGATGGCGGGGATCCTCCCGAGTCTCTGTTGGGCGGAGAGGTGTCTGGTGACGATCACGACCAGCCGCCG
AGCACGCCGCCTTTTCGGTCTCTTCAGCCGGCGGTGTCCGAGCGGGAGCCTTTTATCTCTAAGAGGAGCTCGATC
GACTCGGAGGAGCCCGGCAGTGTTGGTCCCCGGGAGAGCGAGGCCGGCAACGCAACGCCTACGGTTGAGGGCGAG
TTATTTCGACACGATCCTTTCTTCGCCTGGATATTCCTCATCAGTCTCGGCGGCATGATGTCGACATTCATCCTC
GTCTGGCTGCATACGTCTCCGCGCAAGAGCCCGGTCGGCGATACCATCTACACGACGCTGCAAAAGTCGTTCGAC
ATGCTGGCCATCGACACGGTCGTTTCGATCATGGTGTCGCTGGTATGGCTGGCGGCTCTTCGGTCGTTTGTCAGG
CCGCTCGTCAGCGTCATCCTGGTGGCGGTTCCCGTCATCATGCTCTCCTTTTCCCTCTACTCTTTCGTCTCGTCA
TTCCAGGGCCGGACCGGGGGTGCCAGCGCCCAAGACACCGTGATGCGATGGGCGTCTCTGATTCCAGCAGGTGCT
TGCGTCCTCTGGCTTTGGCTCGTGGTCAAGGGCCGTCGAGCCATCCAGCAGGCCATCGAGATGCTGCAGTTCTCG
TCCAAGATCCTGGCTCAGAACCCGGGGCTGCTGGCCGTTGGCTTCGGAAGCCTGGCGCTCATTGTGCTGTGGACC
TGGGCGTGGCTGGCCATGTTCACGCGTGTGTTCATGGGCGGCTACTTCTCGCAGTCGCTGGTTCGGTTCGTGATC
CGGTTGTCGAGCTGGTGGCTGGGCGCGGCCTTTATCCTCATGTACCTGTGGACGTTGGCCGTCATCAACGCCATC
CACCGGGCGACGACGGCGGCGACGGTATCGCAGTGGTACTTTCATCGCAACGCTGGGCCGACGACTGCATCGCGC
GACATCGTGACGGCGGCCCTGAGCCACGCTACGACGACCATGTTTGGCAGCATCTGTCAGTCGACGCTGCTGGCG
CTGCTGCTACGGGCGCCTCTACTCTTCCTGCCTCGACGGGCCGGTACGGCTCTGGCCAACCTGGCGGCCTTTTGG
GTGCCGACGCCCATGATGGCACTGACGAACCCGCTGACGGTAACGTACTCGGCCATACACTCTCAGGGCCTGGTG
ACGTCTGCGCGCGGACTGGACCGGATGGACGTCGTGTCGCCGACGCTGGCGACGACGACTCTGACGCCCCGGGCG
TTGAGGGCTCGCGGCGGTACGGCCAGCGGACTGCTCCCCTATCGACTGGCCAAGCTACTGCTGGTGGCGACGCGC
TTCGCCATGGCCACGGGTCTGGGCTTCGCCGGCTGGATCATGACGGCCAAGCAGCTTCAGATCCAGCTCCCGGAT
GGCATGGGCGTGCGGGGGTCAGCCTACGCGTACGTCGTGGGCATCATGGCCAGCTTCATCGGCTACTCGGTCATG
GGCGCCATGGAGGGCATCCTCAGCGGCATCGTCGACGCCGTCCTCATCTGCTACGGGAGCGAGCGGCGAATGGAA
AGGGGTCAGGGACGCTTCTGCCTCGAGGCTGCTTATCTGTTTGGTGAGGGGAGGGCCGGGGAGGGGGGTTATGTT
TAG
Transcript >Ophcf2|01572
ATGTTTTCGGAGTATGCCTCACGCTTTCTAGCACAGTCACAGTCCCGGCTGTCCAACTTGGGTCAGCCCGAAGGC
GATCACCCGTCGCGACCGGCCGGCGACTGGCCTTCGTCGAGACCCAGTCGTAGAGAGCGAGCGAGCCAGCCGACG
AGGACGATTCTCTCGCGCGGGAATCCCTACCAGCAGAATGGCACTGGGTCGCGCTTCGGTCACTTGGGGTTCGCC
TCGCGTATCTCTGCAGCTCAGGACGCGCCGCTCTTTCACAGCACCTTGGATGAGTTTCGCGAGGAGGATGATGAG
GAGGAGGAGCGGGAGCGTGAGGCTGCCGATTTGTTCGCGCTGCAGCGTTCTAGGCGCGTCGCTGCTGCTAGCAAG
CTCGCCGAGAGTGCCGAGTCGGCTGTCAGCCACGGCTCTGAAGGCGCCACCGCCGCAGACAATCGCCCTCACGAA
TACTCCGGCATCAAGAGTAGCTGGAACGGGGCGCGCAGCAGACATGGGAATCGCCGCCCGTCGTACGGTGCCCTG
ATGGAGGACGGCGAGGATGACGAGGATGATGGTGGAAAGGGAAAGATGGTCGATATCGGGCTGGAGTCCCAGGAG
GATGGCGATGGCGGGGATCCTCCCGAGTCTCTGTTGGGCGGAGAGGTGTCTGGTGACGATCACGACCAGCCGCCG
AGCACGCCGCCTTTTCGGTCTCTTCAGCCGGCGGTGTCCGAGCGGGAGCCTTTTATCTCTAAGAGGAGCTCGATC
GACTCGGAGGAGCCCGGCAGTGTTGGTCCCCGGGAGAGCGAGGCCGGCAACGCAACGCCTACGGTTGAGGGCGAG
TTATTTCGACACGATCCTTTCTTCGCCTGGATATTCCTCATCAGTCTCGGCGGCATGATGTCGACATTCATCCTC
GTCTGGCTGCATACGTCTCCGCGCAAGAGCCCGGTCGGCGATACCATCTACACGACGCTGCAAAAGTCGTTCGAC
ATGCTGGCCATCGACACGGTCGTTTCGATCATGGTGTCGCTGGTATGGCTGGCGGCTCTTCGGTCGTTTGTCAGG
CCGCTCGTCAGCGTCATCCTGGTGGCGGTTCCCGTCATCATGCTCTCCTTTTCCCTCTACTCTTTCGTCTCGTCA
TTCCAGGGCCGGACCGGGGGTGCCAGCGCCCAAGACACCGTGATGCGATGGGCGTCTCTGATTCCAGCAGGTGCT
TGCGTCCTCTGGCTTTGGCTCGTGGTCAAGGGCCGTCGAGCCATCCAGCAGGCCATCGAGATGCTGCAGTTCTCG
TCCAAGATCCTGGCTCAGAACCCGGGGCTGCTGGCCGTTGGCTTCGGAAGCCTGGCGCTCATTGTGCTGTGGACC
TGGGCGTGGCTGGCCATGTTCACGCGTGTGTTCATGGGCGGCTACTTCTCGCAGTCGCTGGTTCGGTTCGTGATC
CGGTTGTCGAGCTGGTGGCTGGGCGCGGCCTTTATCCTCATGTACCTGTGGACGTTGGCCGTCATCAACGCCATC
CACCGGGCGACGACGGCGGCGACGGTATCGCAGTGGTACTTTCATCGCAACGCTGGGCCGACGACTGCATCGCGC
GACATCGTGACGGCGGCCCTGAGCCACGCTACGACGACCATGTTTGGCAGCATCTGTCAGTCGACGCTGCTGGCG
CTGCTGCTACGGGCGCCTCTACTCTTCCTGCCTCGACGGGCCGGTACGGCTCTGGCCAACCTGGCGGCCTTTTGG
GTGCCGACGCCCATGATGGCACTGACGAACCCGCTGACGGTAACGTACTCGGCCATACACTCTCAGGGCCTGGTG
ACGTCTGCGCGCGGACTGGACCGGATGGACGTCGTGTCGCCGACGCTGGCGACGACGACTCTGACGCCCCGGGCG
TTGAGGGCTCGCGGCGGTACGGCCAGCGGACTGCTCCCCTATCGACTGGCCAAGCTACTGCTGGTGGCGACGCGC
TTCGCCATGGCCACGGGTCTGGGCTTCGCCGGCTGGATCATGACGGCCAAGCAGCTTCAGATCCAGCTCCCGGAT
GGCATGGGCGTGCGGGGGTCAGCCTACGCGTACGTCGTGGGCATCATGGCCAGCTTCATCGGCTACTCGGTCATG
GGCGCCATGGAGGGCATCCTCAGCGGCATCGTCGACGCCGTCCTCATCTGCTACGGGAGCGAGCGGCGAATGGAA
AGGGGTCAGGGACGCTTCTGCCTCGAGGCTGCTTATCTGTTTGGTGAGGGGAGGGCCGGGGAGGGGGGTTATGTT
TAG
Gene >Ophcf2|01572
ATGTTTTCGGAGTGTGCGTTAGGCCCAGCCTCGCACGTCGCCTTGCTGGCTGTACTGACGCCCGCCGGCCAGATG
CCTCACGCTTTCTAGCACAGTCACAGTCCCGGCTGTCCAACTTGGGTCAGCCCGAAGGCGATCACCCGTCGCGAC
CGGCCGGCGACTGGCCTTCGTCGAGACCCAGTCGTAGAGAGCGAGCGAGCCAGCCGACGAGGACGATTCTCTCGC
GCGGGAATCCCTACCAGCAGAATGGCACTGGGTCGCGCTTCGGTCACTTGGGGTTCGCCTCGCGTATCTCTGCAG
CTCAGGACGCGCCGCTCTTTCACAGCACCTTGGATGAGTTTCGCGAGGAGGATGATGAGGAGGAGGAGCGGGAGC
GTGAGGCTGCCGATTTGTTCGCGCTGCAGCGTTCTAGGCGCGTCGCTGCTGCTAGCAAGCTCGCCGAGAGTGCCG
AGTCGGCTGTCAGCCACGGCTCTGAAGGCGCCACCGCCGCAGACAATCGCCCTCACGAATACTCCGGCATCAAGA
GTAGCTGGAACGGGGCGCGCAGCAGACATGGGAATCGCCGCCCGTCGTACGGTGCCCTGATGGAGGACGGCGAGG
ATGACGAGGATGATGGTGGAAAGGGAAAGATGGTCGATATCGGGCTGGAGTCCCAGGAGGATGGCGATGGCGGGG
ATCCTCCCGAGTCTCTGTTGGGCGGAGAGGTGTCTGGTGACGATCACGACCAGCCGCCGAGCACGCCGCCTTTTC
GGTCTCTTCAGCCGGCGGTGTCCGAGCGGGAGCCTTTTATCTCTAAGAGGAGCTCGATCGACTCGGAGGAGCCCG
GCAGTGTTGGTCCCCGGGAGAGCGAGGCCGGCAACGCAACGCCTACGGTTGAGGGCGAGTTATTTCGACACGATC
CTTTCTTCGCCTGGATATTCCTCATCAGTCTCGGCGGCATGATGTCGACATTCATCCTCGTCTGGCTGCATACGT
CTCCGCGCAAGAGCCCGGTCGGCGATACCATCTACACGACGCTGCAAAAGTCGTTCGACATGCTGGCCATCGACA
CGGTCGTTTCGATCATGGTGTCGCTGGTATGGCTGGCGGCTCTTCGGTCGTTTGTCAGGCCGCTCGTCAGCGTCA
TCCTGGTGGCGGTTCCCGTCATCATGCTCTCCTTTTCCCTCTACTCTTTCGTCTCGTCATTCCAGGGCCGGACCG
GGGGTGCCAGCGCCCAAGACACCGTGATGCGATGGGCGTCTCTGATTCCAGCAGGTGCTTGCGTCCTCTGGCTTT
GGCTCGTGGTCAAGGGCCGTCGAGCCATCCAGCAGGCCATCGAGATGCTGCAGTTCTCGTCCAAGATCCTGGCTC
AGAACCCGGGGCTGCTGGCCGTTGGCTTCGGAAGCCTGGCGCTCATTGTGCTGTGGACCTGGGCGTGGCTGGCCA
TGTTCACGCGTGTGTTCATGGGCGGCTACTTCTCGCAGTCGCTGGTTCGGTTCGTGATCCGGTTGTCGAGCTGGT
GGCTGGGCGCGGCCTTTATCCTCATGTACCTGTGGACGTTGGCCGTCATCAACGCCATCCACCGGGCGACGACGG
CGGCGACGGTATCGCAGTGGTACTTTCATCGCAACGCTGGGCCGACGACTGCATCGCGCGACATCGTGACGGCGG
CCCTGAGCCACGCTACGACGACCATGTTTGGCAGCATCTGTCAGTCGACGCTGCTGGCGCTGCTGCTACGGGCGC
CTCTACTCTTCCTGCCTCGACGGGCCGGTACGGCTCTGGCCAACCTGGCGGCCTTTTGGGTGCCGACGCCCATGA
TGGCACTGACGAACCCGCTGACGGTAACGTACTCGGCCATACACTCTCAGGGCCTGGTGACGTCTGCGCGCGGAC
TGGACCGGATGGACGTCGTGTCGCCGACGCTGGCGACGACGACTCTGACGCCCCGGGCGTTGAGGGCTCGCGGCG
GTACGGCCAGCGGACTGCTCCCCTATCGACTGGCCAAGCTACTGCTGGTGGCGACGCGCTTCGCCATGGCCACGG
GTCTGGGCTTCGCCGGCTGGATCATGACGGCCAAGCAGCTTCAGATCCAGCTCCCGGATGGCATGGGCGTGCGGG
GGTCAGCCTACGCGTACGTCGTGGGCATCATGGCCAGCTTCATCGGCTACTCGGTCATGGGCGCCATGGAGGGCA
TCCTCAGCGGCATCGTCGACGCCGTCCTCATCTGCTACGGGAGCGAGCGGCGAATGGAAAGGGGTCAGGGACGCT
TCTGCCTCGAGGCTGCTTATCTGTTTGGTGAGGGGAGGGCCGGGGAGGGGGGTTATGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail