Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01569
Gene name
Locationscaffold_01:5360853..5361168
Strand-
Gene length (bp)315
Transcript length (bp)219
Coding sequence length (bp)219
Protein length (aa) 73

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12554 MOZART1 Mitotic-spindle organizing gamma-tubulin ring associated 6.8E-24 11 57

GO

GO Term Description Terminal node
GO:0033566 gamma-tubulin complex localization Yes
GO:0000931 gamma-tubulin large complex Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0000930 gamma-tubulin complex No
GO:0031503 protein-containing complex localization No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6137 0.437 0.0698 0.0633 0.1907 0.0361 0.0559 0.0461 0.058 0.0039

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5068
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|5133
Ophiocordyceps camponoti-floridani Ophcf2|01569 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7064
Ophiocordyceps kimflemingae Ophio5|5572
Ophiocordyceps subramaniannii Hirsu2|2876

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01569
MPDSDKHAAAQQAVDILHEIAIILNTNLDRRTLSICISMIERGVNPEALAQVIKELRREAQLAEGNASTTRP*
Coding >Ophcf2|01569
ATGCCCGACTCAGACAAACACGCAGCCGCGCAACAAGCCGTCGACATCCTCCACGAGATTGCCATCATCCTGAAC
ACCAACCTGGATCGTCGCACCTTGTCCATCTGCATCTCCATGATCGAGCGCGGCGTCAACCCGGAAGCTCTTGCG
CAAGTCATCAAGGAACTGCGCCGCGAGGCTCAACTCGCCGAAGGCAACGCATCAACGACGCGTCCGTAA
Transcript >Ophcf2|01569
ATGCCCGACTCAGACAAACACGCAGCCGCGCAACAAGCCGTCGACATCCTCCACGAGATTGCCATCATCCTGAAC
ACCAACCTGGATCGTCGCACCTTGTCCATCTGCATCTCCATGATCGAGCGCGGCGTCAACCCGGAAGCTCTTGCG
CAAGTCATCAAGGAACTGCGCCGCGAGGCTCAACTCGCCGAAGGCAACGCATCAACGACGCGTCCGTAA
Gene >Ophcf2|01569
ATGCCCGACTCAGACAAACACGCAGCCGCGCAACAAGCCGTCGACATCCTCCACGAGATTGCCATCATCCTGGTT
CGTCGCCAGCCCCCCTGCCTCTCCCTCGCTAATAGCCGCAGAACACCAACCTGGATCGTCGCACCTTGTCCATCT
GCATCTCCATGATCGAGCGCGGCGTCAACCCGGAAGCTCTTGCGGTACGCGCCGTCTGCTCTTGCCCTTGAGACG
ATTGCTGACGCGTCCTCGCAGCAAGTCATCAAGGAACTGCGCCGCGAGGCTCAACTCGCCGAAGGCAACGCATCA
ACGACGCGTCCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail