Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01568
Gene name
Locationscaffold_01:5358877..5360644
Strand+
Gene length (bp)1767
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14599 zinc_ribbon_6 Zinc-ribbon 2.2E-25 354 410
PF05495 zf-CHY CHY zinc finger 9.7E-20 178 251
PF14634 zf-RING_5 zinc-RING finger domain 1.2E-07 307 350
PF13639 zf-RING_2 Ring finger domain 2.9E-07 306 349
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 8.3E-05 307 348

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6214 0.8148 0.0161 0.0441 0.2196 0.0017 0.1611 0.1047 0.1203 0.096

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2239
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7088
Ophiocordyceps australis map64 (Brazil) OphauB2|5134
Ophiocordyceps camponoti-floridani Ophcf2|01568 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7065
Ophiocordyceps kimflemingae Ophio5|5573
Ophiocordyceps subramaniannii Hirsu2|2877

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01568
MDHLPDHSPDHSPDPLEPLAVQEASPPMANPGLLIPADDGMRELRCRIQAINARDIAPSHKAMLMHEALLEPYRA
SQAAALRDGTSSTSTSASASASAPDSEPTAHQTWEHKISSRPLDPLRFWHGQFGDAPVSEKFVLSETDVAPTYAP
IRQPKSSGGSTPTILPSPPADLSPPLGCQHYERNVKLQCSTCFKWYTCRFCHDAREEHSLVRRETRNMLCMLCGT
PQRASDVCVGCGETAAQYYCNICKLWENRQSKPIYHCNDCGICRRGLGLGKDFFHCKTCRACITTSIQSSHKCIE
RSTDCDCPICGEYMFTSPKPVVFMSCGHSIHKKCYDQHMKVSYKCPICNKSLANMETQFRNLDVAIQSQPMPPEF
RGTRATVLCNDCSGRSTVAYHWLGLKCSICRSYNTVELQIHGEESEHLRAAVESREPPPPADPSQETAMPSAIPV
GSHAGGALLFNRRRRHSSHSREPVFRVTGGVAPSLSPLGVSVDNLCLSPMTNDAESEDDILGFWGRIRTGGADSE
DEGEYDSDLDDAPDGDDDDEDDEDEIILIGHR*
Coding >Ophcf2|01568
ATGGACCATCTCCCGGATCATTCCCCGGACCATTCCCCGGACCCTCTCGAGCCTCTCGCCGTCCAAGAAGCATCG
CCACCCATGGCTAACCCGGGCCTGCTCATCCCCGCCGACGACGGTATGCGCGAACTGCGCTGTCGCATCCAGGCC
ATCAACGCTCGAGACATAGCACCCTCACACAAGGCCATGCTCATGCACGAGGCCCTACTCGAGCCCTACCGCGCC
TCTCAAGCCGCCGCCCTACGCGACGGGACCTCCTCCACCTCCACCTCGGCCTCGGCCTCGGCCTCGGCCCCGGAC
TCGGAGCCCACGGCTCATCAGACGTGGGAGCACAAGATCTCGTCCCGGCCTCTCGATCCCCTGAGGTTCTGGCAC
GGTCAATTCGGCGACGCGCCCGTCTCCGAAAAGTTTGTCCTCTCAGAGACCGACGTCGCACCCACCTACGCGCCC
ATCCGGCAACCCAAGAGCTCCGGCGGTTCGACGCCCACGATACTACCCTCGCCACCGGCCGACTTGAGCCCTCCA
CTCGGATGTCAGCATTACGAACGCAACGTCAAGTTGCAGTGCTCCACCTGCTTCAAGTGGTACACCTGCCGCTTC
TGCCACGATGCCCGCGAGGAGCACAGCCTGGTCCGCAGAGAGACGCGCAACATGCTCTGCATGCTCTGCGGCACT
CCTCAGAGGGCGTCCGACGTCTGCGTCGGGTGCGGAGAGACGGCCGCCCAGTACTACTGCAACATCTGCAAGCTG
TGGGAGAACAGACAGAGCAAGCCAATCTACCACTGCAACGACTGCGGCATCTGTCGCCGGGGGCTGGGTCTCGGC
AAGGATTTCTTCCACTGCAAGACTTGCCGCGCGTGCATCACGACGTCGATCCAGAGCTCACACAAGTGCATCGAG
CGGTCCACCGACTGCGACTGTCCCATCTGCGGCGAGTACATGTTCACTTCGCCAAAGCCCGTCGTCTTCATGAGC
TGCGGCCACAGCATCCACAAGAAATGCTACGATCAGCACATGAAGGTCTCGTACAAGTGTCCCATCTGCAATAAG
AGCCTCGCCAACATGGAGACGCAATTCCGCAACCTCGACGTCGCCATCCAGAGCCAGCCCATGCCCCCCGAGTTT
CGAGGCACCCGGGCCACTGTACTCTGCAACGACTGCTCTGGGAGGAGCACCGTCGCCTACCACTGGCTCGGCCTC
AAGTGCTCCATATGCCGCTCGTACAATACCGTCGAGCTCCAGATACACGGCGAAGAGAGCGAGCACCTCCGGGCA
GCCGTCGAGAGTCGGGAGCCTCCGCCGCCGGCCGATCCCAGCCAGGAGACGGCCATGCCATCGGCCATTCCGGTG
GGCTCGCATGCAGGTGGCGCCCTGCTGTTCAACCGTCGCAGGCGCCACTCATCCCACAGCCGAGAGCCCGTGTTC
CGTGTGACGGGAGGTGTGGCGCCATCGCTATCTCCACTAGGCGTGAGCGTCGACAATCTGTGTCTGTCGCCCATG
ACCAACGACGCCGAGTCGGAAGATGACATACTCGGTTTTTGGGGCCGCATTCGCACAGGAGGAGCCGACTCGGAA
GACGAGGGCGAATACGATTCAGATCTGGACGACGCGCCCGATGGCGATGATGACGACGAGGACGACGAAGACGAA
ATTATTTTAATTGGACATCGGTAG
Transcript >Ophcf2|01568
ATGGACCATCTCCCGGATCATTCCCCGGACCATTCCCCGGACCCTCTCGAGCCTCTCGCCGTCCAAGAAGCATCG
CCACCCATGGCTAACCCGGGCCTGCTCATCCCCGCCGACGACGGTATGCGCGAACTGCGCTGTCGCATCCAGGCC
ATCAACGCTCGAGACATAGCACCCTCACACAAGGCCATGCTCATGCACGAGGCCCTACTCGAGCCCTACCGCGCC
TCTCAAGCCGCCGCCCTACGCGACGGGACCTCCTCCACCTCCACCTCGGCCTCGGCCTCGGCCTCGGCCCCGGAC
TCGGAGCCCACGGCTCATCAGACGTGGGAGCACAAGATCTCGTCCCGGCCTCTCGATCCCCTGAGGTTCTGGCAC
GGTCAATTCGGCGACGCGCCCGTCTCCGAAAAGTTTGTCCTCTCAGAGACCGACGTCGCACCCACCTACGCGCCC
ATCCGGCAACCCAAGAGCTCCGGCGGTTCGACGCCCACGATACTACCCTCGCCACCGGCCGACTTGAGCCCTCCA
CTCGGATGTCAGCATTACGAACGCAACGTCAAGTTGCAGTGCTCCACCTGCTTCAAGTGGTACACCTGCCGCTTC
TGCCACGATGCCCGCGAGGAGCACAGCCTGGTCCGCAGAGAGACGCGCAACATGCTCTGCATGCTCTGCGGCACT
CCTCAGAGGGCGTCCGACGTCTGCGTCGGGTGCGGAGAGACGGCCGCCCAGTACTACTGCAACATCTGCAAGCTG
TGGGAGAACAGACAGAGCAAGCCAATCTACCACTGCAACGACTGCGGCATCTGTCGCCGGGGGCTGGGTCTCGGC
AAGGATTTCTTCCACTGCAAGACTTGCCGCGCGTGCATCACGACGTCGATCCAGAGCTCACACAAGTGCATCGAG
CGGTCCACCGACTGCGACTGTCCCATCTGCGGCGAGTACATGTTCACTTCGCCAAAGCCCGTCGTCTTCATGAGC
TGCGGCCACAGCATCCACAAGAAATGCTACGATCAGCACATGAAGGTCTCGTACAAGTGTCCCATCTGCAATAAG
AGCCTCGCCAACATGGAGACGCAATTCCGCAACCTCGACGTCGCCATCCAGAGCCAGCCCATGCCCCCCGAGTTT
CGAGGCACCCGGGCCACTGTACTCTGCAACGACTGCTCTGGGAGGAGCACCGTCGCCTACCACTGGCTCGGCCTC
AAGTGCTCCATATGCCGCTCGTACAATACCGTCGAGCTCCAGATACACGGCGAAGAGAGCGAGCACCTCCGGGCA
GCCGTCGAGAGTCGGGAGCCTCCGCCGCCGGCCGATCCCAGCCAGGAGACGGCCATGCCATCGGCCATTCCGGTG
GGCTCGCATGCAGGTGGCGCCCTGCTGTTCAACCGTCGCAGGCGCCACTCATCCCACAGCCGAGAGCCCGTGTTC
CGTGTGACGGGAGGTGTGGCGCCATCGCTATCTCCACTAGGCGTGAGCGTCGACAATCTGTGTCTGTCGCCCATG
ACCAACGACGCCGAGTCGGAAGATGACATACTCGGTTTTTGGGGCCGCATTCGCACAGGAGGAGCCGACTCGGAA
GACGAGGGCGAATACGATTCAGATCTGGACGACGCGCCCGATGGCGATGATGACGACGAGGACGACGAAGACGAA
ATTATTTTAATTGGACATCGGTAG
Gene >Ophcf2|01568
ATGGACCATCTCCCGGATCATTCCCCGGACCATTCCCCGGACCCTCTCGAGCCTCTCGCCGTCCAAGAAGCATCG
CCACCCATGGCTAACCCGGGCCTGCTCATCCCCGCCGACGACGGTATGCGCGAACTGCGCTGTCGCATCCAGGCC
ATCAACGCTCGAGACATAGCACCCTCACACAAGGCCATGCTCATGCACGAGGCCCTACTCGAGCCCTACCGCGCC
TCTCAAGCCGCCGCCCTACGCGACGGGACCTCCTCCACCTCCACCTCGGCCTCGGCCTCGGCCTCGGCCCCGGAC
TCGGAGCCCACGGCTCATCAGACGTGGGAGCACAAGATCTCGTCCCGGCCTCTCGATCCCCTGAGGTTCTGGCAC
GGTCAATTCGGCGACGCGCCCGTCTCCGAAAAGTTTGTCCTCTCAGAGACCGACGTCGCACCCACCTACGCGCCC
ATCCGGCAACCCAAGAGCTCCGGCGGTTCGACGCCCACGATACTACCCTCGCCACCGGCCGACTTGAGCCCTCCA
CTCGGATGTCAGCATTACGAACGCAACGTCAAGTTGCAGTGCTCCACCTGCTTCAAGTGGTACACCTGCCGCTTC
TGCCACGATGCCCGCGAGGAGCACAGCCTGGTCCGCAGAGAGACGCGCAACATGCTCTGCATGCTCTGCGGCACT
CCTCAGAGGGCGTCCGACGTCTGCGTCGGGTGCGGAGAGACGGCCGCCCAGTACTACTGCAACATCTGCAAGCTG
TGGGAGAACAGACAGAGCAAGCCAATCTACCACTGCAACGACTGCGGCATCTGTCGCCGGGGGCTGGGTCTCGGC
AAGGATTTCTTCCACTGCAAGGTGCGTCCTCTTCCCCCCCCCCCCCAGAGTTAAAGGGTGCCTCCTCTATCTATA
GTGCTGCTGGCTGACCGGGGCACAACAAAATACAAAAAGACTTGCCGCGCGTGCATCACGACGTCGATCCAGAGC
TCACACAAGTGCATCGAGCGGTCCACCGACTGCGACTGTCCCATCTGCGGCGAGTACATGTTCACTTCGCCAAAG
CCCGTCGTCTTCATGAGCTGCGGCCACAGCATCCACAAGAAATGCTACGATCAGCACATGAAGGTCTCGTACAAG
TGTCCCATCTGCAATAAGAGCCTCGCCAACATGGAGACGCAATTCCGCAACCTCGACGTCGCCATCCAGAGCCAG
CCCATGCCCCCCGAGTTTCGAGGCACCCGGGCCACTGTACTCTGCAACGACTGCTCTGGGAGGAGCACCGTCGCC
TACCACTGGCTCGGCCTCAAGTGCTCCATATGCCGCTCGTACAATACCGTCGAGCTCCAGATACACGGCGAAGAG
AGCGAGCACCTCCGGGCAGCCGTCGAGAGTCGGGAGCCTCCGCCGCCGGCCGATCCCAGCCAGGAGACGGCCATG
CCATCGGCCATTCCGGTGGGCTCGCATGCAGGTGGCGCCCTGCTGTTCAACCGTCGCAGGCGCCACTCATCCCAC
AGCCGAGAGCCCGTGTTCCGTGTGACGGGAGGTGTGGCGCCATCGCTATCTCCACTAGGCGTGAGCGTCGACAAT
CTGTGTCTGTCGCCCATGACCAACGACGCCGAGTCGGAAGATGACATACTCGGTTTTTGGGGCCGCATTCGCACA
GGAGGAGCCGACTCGGAAGACGAGGGCGAATACGATTCAGATCTGGACGACGCGCCCGATGGCGATGATGACGAC
GAGGACGACGAAGACGAAATTATTTTAATTGGACATCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail