Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01566
Gene name
Locationscaffold_01:5347367..5348113
Strand-
Gene length (bp)746
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06201 PITH PITH domain 2.7E-44 31 176

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6977 0.6583 0.0742 0.0393 0.1372 0.0057 0.0505 0.1255 0.062 0.0381

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5067
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3161
Ophiocordyceps australis map64 (Brazil) OphauB2|5130
Ophiocordyceps camponoti-floridani Ophcf2|01566 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6448
Ophiocordyceps kimflemingae Ophio5|5568
Ophiocordyceps subramaniannii Hirsu2|2873

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01566
MSHCHDEHHSHGHDSSHDHSDDITPALQSSLYEQIDFDQMTTLNEATRHAGKAVVKKTWAERMEIEPELVSDADE
QLLMTIPFTAQVKLHSILIRTSPSASAPRTLDLYVNQPNLDFSSAEDAEATQRLELSQTSDVQDIPVRRALFSKV
TQLSLLVRDNFGDDVSRLSYLGFRGEWTRLGRAPEQIVYEAAPQPGDHRLRGTGVNEVGGGSGAWVVKGAGWFC*
Coding >Ophcf2|01566
ATGTCGCACTGCCACGACGAACACCACAGTCACGGCCATGACAGCAGCCACGACCACTCAGACGACATCACTCCT
GCGCTCCAGTCGTCGCTGTACGAGCAGATCGACTTTGACCAGATGACGACTCTCAACGAGGCAACCAGGCACGCC
GGAAAGGCCGTCGTAAAGAAGACGTGGGCGGAGAGGATGGAGATTGAGCCTGAGCTTGTCAGCGACGCAGACGAG
CAGCTGCTGATGACGATACCCTTCACGGCACAGGTGAAGCTACACTCGATCCTCATCCGAACCTCCCCCTCAGCC
TCAGCCCCCCGAACCCTAGACCTCTACGTCAACCAACCCAACCTCGACTTCAGCAGCGCCGAAGACGCCGAAGCA
ACGCAACGACTCGAACTATCGCAAACCTCGGACGTGCAAGACATACCCGTCCGACGCGCCCTCTTCAGCAAGGTG
ACGCAGCTGAGCCTGCTGGTGAGGGATAACTTCGGCGACGACGTCTCGCGCCTCTCGTACTTGGGCTTTCGCGGC
GAGTGGACTAGGTTGGGGAGGGCGCCAGAGCAGATTGTTTATGAGGCGGCGCCGCAGCCCGGTGATCATCGGCTT
AGGGGGACGGGGGTTAATGAGGTTGGGGGGGGATCGGGGGCGTGGGTTGTGAAGGGGGCTGGCTGGTTCTGTTGA
Transcript >Ophcf2|01566
ATGTCGCACTGCCACGACGAACACCACAGTCACGGCCATGACAGCAGCCACGACCACTCAGACGACATCACTCCT
GCGCTCCAGTCGTCGCTGTACGAGCAGATCGACTTTGACCAGATGACGACTCTCAACGAGGCAACCAGGCACGCC
GGAAAGGCCGTCGTAAAGAAGACGTGGGCGGAGAGGATGGAGATTGAGCCTGAGCTTGTCAGCGACGCAGACGAG
CAGCTGCTGATGACGATACCCTTCACGGCACAGGTGAAGCTACACTCGATCCTCATCCGAACCTCCCCCTCAGCC
TCAGCCCCCCGAACCCTAGACCTCTACGTCAACCAACCCAACCTCGACTTCAGCAGCGCCGAAGACGCCGAAGCA
ACGCAACGACTCGAACTATCGCAAACCTCGGACGTGCAAGACATACCCGTCCGACGCGCCCTCTTCAGCAAGGTG
ACGCAGCTGAGCCTGCTGGTGAGGGATAACTTCGGCGACGACGTCTCGCGCCTCTCGTACTTGGGCTTTCGCGGC
GAGTGGACTAGGTTGGGGAGGGCGCCAGAGCAGATTGTTTATGAGGCGGCGCCGCAGCCCGGTGATCATCGGCTT
AGGGGGACGGGGGTTAATGAGGTTGGGGGGGGATCGGGGGCGTGGGTTGTGAAGGGGGCTGGCTGGTTCTGTTGA
Gene >Ophcf2|01566
ATGTCGCACTGCCACGACGAACACCACAGTCACGGCCATGACAGCAGCCACGACCACTCAGACGACATCACTCCT
GCGCTCCAGTCGTCGCTGTACGAGCAGATCGACTTTGACCAGATGACGACTCTCAACGAGGCAACCAGGCACGCC
GGAAAGGCCGTCGTAAAGAAGACGTGGGCGGAGAGGATGGAGATTGAGCCTGAGCTTGTCAGCGACGCAGACGAG
CAGCTGCTGATGACGATACCGTTCGTCTTTTCTTCCCCCTTTATCCTCTCGCCTCCACAAGCGCAAGCAAACAGG
CTGATGCAAAAACCAGCTTCACGGCACAGGTGAAGCTACACTCGATCCTCATCCGAACCTCCCCCTCAGCCTCAG
CCCCCCGAACCCTAGACCTCTACGTCAACCAACCCAACCTCGACTTCAGCAGCGCCGAAGACGCCGAAGCAACGC
AACGACTCGAACTATCGCAAACCTCGGACGTGCAAGACATACCCGTCCGACGCGCCCTCTTCAGCAAGGTGACGC
AGCTGAGCCTGCTGGTGAGGGATAACTTCGGCGACGACGTCTCGCGCCTCTCGTACTTGGGCTTTCGCGGCGAGT
GGACTAGGTTGGGGAGGGCGCCAGAGCAGATTGTTTATGAGGCGGCGCCGCAGCCCGGTGATCATCGGCTTAGGG
GGACGGGGGTTAATGAGGTTGGGGGGGGATCGGGGGCGTGGGTTGTGAAGGGGGCTGGCTGGTTCTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail