Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01561
Gene name
Locationscaffold_01:5336113..5339462
Strand+
Gene length (bp)3349
Transcript length (bp)2976
Coding sequence length (bp)2976
Protein length (aa) 992

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.7E-06 269 348
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.6E-08 354 415
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.0E-11 427 510
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-07 324 376
PF13637 Ank_4 Ankyrin repeats (many copies) 6.9E-05 359 410
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-04 428 477
PF13637 Ank_4 Ankyrin repeats (many copies) 1.5E-07 458 509
PF03105 SPX SPX domain 3.4E-09 107 165
PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family 1.6E-07 725 977

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008081 phosphoric diester hydrolase activity Yes
GO:0005515 protein binding Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6401 0.6607 0.0541 0.1064 0.0652 0.0131 0.1396 0.2819 0.2339 0.003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 121.86 61.12 182.59
Alive In ants, during behavior modification 152.32 71.24 233.41
Dead In ants, recently dead 130.16 64.25 196.07

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.337939 no
Alive Dead 0.462295 no
Dead Fungus 0.806684 no

Orthologs

Orthofinder run ID4
Orthogroup1067
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3165
Ophiocordyceps australis map64 (Brazil) OphauB2|5126
Ophiocordyceps camponoti-floridani Ophcf2|01561 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6985
Ophiocordyceps kimflemingae Ophio5|5564
Ophiocordyceps subramaniannii Hirsu2|10018

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01561
MQFGKHIQKRQLEIPEYCASFVNYKALKKLIKKLSATPTLPALDDANRPSAAGASSQSALQANKATFFFQLEREL
DKVNAFYLQKEAELKIRLKTLLDKKKVLQTRPDVPRRSSKFTTLEEGFQQFATDLNKLQHFVDINGTAFSKILKK
WDKTSKSRTKELYLSRAVEVQPFFNAPVISELSDQVTTSLQELGAWSDGIQVNFNASGHVVPSQHFDEADADTLL
FDTVVSGNLESLSDLLAKTRDGESPMTDRVTRTFLTAVHDAPRESLQMLLDTGLVDLHSYDDINERNCLHQAAIY
GKQHVLEWGLKAAVAVDRTDVYGRAPLHYTSQHGRLEMLEMLLDADPRTIDLADHDNFTPLIHAIRHGHLDCVQR
LVARSARIDPVPDAGHAPLNLACERASEPVVELLLRHGAQMLPDAEGLYPQHLVARSGKSSNLLLLLKQYGADLD
QADKLYGWTPLVHAASEGNVDCLQTLLRIGVDAHVVDEKGLPAMYYAAWEGHLECMKLLSPLDGQSSSRIGPLVG
KPSPAAAAPVPMALDPDGIPELELPPPIIPLRRYGHNFLDTKTVVQISFDEAQGPALVFFQDGKYPAARLTISSK
LSGLIPKNIILPFQEDTRNVSFQVDNIDSFSLDLDVFPTYGAKVIARTVALPSVLGPHQGSSSSCLPLFDPRLRA
IGQISFTADVIRPFQGHSLEIADFETYWKATSQLDQPTSAVVTGSSLCGDYVRLPVQHTGDGVPVVWSRWTVTCG
GGIDLPVCRLSLKQFRALAGRRAEIPAVAPTATADEVAGMFRTGEAAGATLAEALAVLPPAVHVNLQVLHPTADQ
ERTLGLGPALDVNPSVDSILADVFEDARAQRAQRRPPDGARSVVFSSYSARVCAALNWKQPNFPVFLCNDLGREP
DSGLDAARRSTSIKEAVRIAQSNNLMGLMCFGRLLEMVPALVDAIKSHGLALVTDKSTDASSSDSSSQVPKGVDG
VLRHHGILRFNDSIDI*
Coding >Ophcf2|01561
ATGCAATTCGGCAAGCATATCCAGAAGCGTCAGCTCGAGATCCCCGAGTATTGCGCCAGCTTCGTCAACTACAAG
GCCCTCAAAAAGCTCATCAAGAAGCTGTCCGCCACGCCGACGCTGCCCGCCCTAGATGACGCCAATCGTCCGTCG
GCAGCCGGCGCCTCCTCCCAGTCTGCCCTTCAGGCTAACAAGGCCACCTTCTTTTTCCAGCTGGAGCGAGAGCTC
GACAAGGTGAATGCCTTTTACTTGCAAAAGGAAGCCGAGCTCAAGATCCGGCTCAAGACGCTGCTTGACAAGAAA
AAGGTGCTGCAGACGCGTCCCGATGTCCCTCGGCGGTCCTCCAAGTTTACCACTCTCGAGGAGGGCTTTCAGCAG
TTCGCCACGGACCTGAATAAGCTGCAGCACTTCGTCGACATCAACGGCACCGCCTTTTCCAAGATTCTCAAGAAG
TGGGACAAGACATCCAAGTCCAGGACCAAGGAACTCTATCTGTCCCGCGCCGTCGAGGTTCAGCCCTTCTTCAAC
GCCCCCGTCATCAGCGAGCTGTCGGACCAGGTCACCACCAGCTTACAGGAGCTGGGTGCCTGGTCCGACGGAATC
CAGGTCAACTTCAACGCCTCGGGCCACGTCGTGCCCAGTCAGCACTTTGACGAGGCTGATGCCGATACGCTCTTG
TTCGACACTGTCGTCTCCGGCAACCTCGAGTCGTTGAGCGATCTCCTGGCCAAGACGCGCGACGGCGAGAGCCCC
ATGACGGATCGAGTCACCCGCACCTTTCTGACGGCCGTACACGATGCACCGCGCGAGTCGCTGCAGATGCTGCTC
GATACGGGCCTCGTCGACCTGCACTCGTACGACGACATCAATGAGCGCAACTGCCTGCACCAGGCCGCCATCTAT
GGCAAGCAGCACGTGCTGGAATGGGGCCTGAAAGCCGCCGTCGCCGTCGACCGAACCGATGTCTACGGACGGGCG
CCTCTGCACTACACCAGCCAACACGGCCGGCTGGAGATGCTGGAGATGCTGCTGGATGCCGATCCCCGGACGATA
GACCTGGCTGATCACGACAACTTTACACCGCTGATCCACGCCATCCGCCACGGCCACCTCGACTGCGTCCAGCGC
CTCGTAGCCCGTTCAGCACGTATCGACCCCGTGCCGGACGCGGGCCATGCGCCCCTGAACCTGGCCTGCGAACGC
GCGTCGGAGCCGGTGGTGGAGCTCCTGTTGCGTCACGGCGCCCAGATGCTACCGGACGCCGAGGGCCTGTATCCC
CAGCACCTGGTGGCCCGGTCCGGCAAGTCGTCCAACCTGCTGCTGCTTCTGAAGCAGTACGGCGCCGACCTGGAC
CAGGCCGACAAGCTCTACGGCTGGACGCCGCTGGTGCACGCCGCCAGCGAAGGCAACGTCGACTGCCTGCAGACG
CTGCTCCGGATCGGCGTCGACGCCCACGTCGTGGACGAAAAGGGTTTGCCAGCCATGTACTACGCCGCCTGGGAA
GGCCACCTCGAATGCATGAAGCTCCTGTCGCCGCTGGACGGGCAGAGCAGCAGCAGGATCGGTCCGCTCGTCGGC
AAGCCTTCGCCGGCAGCGGCCGCTCCGGTGCCCATGGCGCTGGATCCCGACGGCATCCCGGAGCTGGAGCTGCCG
CCGCCCATCATCCCGCTCCGGCGCTACGGTCACAACTTCCTCGACACCAAGACGGTGGTGCAGATCAGCTTCGAC
GAGGCTCAGGGGCCGGCTCTCGTCTTCTTCCAGGACGGCAAGTATCCGGCTGCGCGACTGACCATCTCGTCCAAG
CTATCGGGCCTCATCCCAAAGAACATCATTCTTCCCTTTCAAGAGGACACGCGAAACGTGTCCTTCCAAGTCGAT
AACATCGACTCCTTCTCCCTCGATCTAGATGTGTTCCCGACGTACGGGGCCAAGGTCATCGCCCGGACGGTGGCG
CTGCCGAGCGTGCTGGGGCCACACCAGGGCAGCTCGAGCAGCTGCCTGCCGCTGTTTGACCCTCGATTGCGGGCC
ATCGGACAGATCAGCTTCACGGCGGATGTGATCCGGCCCTTTCAAGGACACTCGCTGGAGATTGCCGACTTCGAG
ACGTACTGGAAGGCTACGAGCCAGCTGGACCAGCCGACGAGCGCCGTGGTCACAGGGTCGAGCCTCTGCGGGGAC
TACGTCCGGTTGCCGGTGCAGCACACGGGCGACGGGGTGCCGGTCGTTTGGTCGCGGTGGACGGTGACCTGCGGC
GGCGGTATCGATTTGCCCGTGTGCCGGCTTTCACTGAAACAGTTTCGGGCCTTGGCCGGGCGGCGGGCCGAGATT
CCGGCAGTGGCTCCGACAGCGACGGCCGACGAGGTCGCCGGCATGTTCCGGACCGGGGAGGCGGCGGGGGCAACG
CTCGCCGAGGCACTGGCGGTGCTGCCACCGGCGGTACACGTCAATCTCCAGGTGCTGCACCCGACGGCCGACCAG
GAGAGGACTCTCGGGCTCGGCCCGGCCCTTGACGTCAACCCGTCGGTCGACTCGATCCTCGCCGACGTCTTTGAA
GACGCGCGCGCGCAGAGGGCACAGCGCCGGCCGCCCGACGGGGCGCGTTCGGTGGTCTTTAGCAGCTATAGCGCC
AGGGTCTGCGCCGCTCTCAACTGGAAGCAGCCCAACTTTCCCGTCTTTCTGTGCAATGACCTCGGCCGGGAGCCC
GATTCGGGTCTGGACGCGGCCAGGAGGAGTACGTCCATCAAGGAGGCGGTGCGCATCGCCCAGAGCAACAATCTT
ATGGGGCTCATGTGCTTCGGGCGCCTGCTGGAGATGGTGCCGGCACTCGTGGATGCCATCAAGTCGCATGGACTC
GCCCTTGTCACAGATAAGTCAACGGATGCTTCGTCTAGTGACTCGTCCTCGCAGGTGCCCAAGGGCGTCGACGGC
GTGCTCCGTCATCATGGTATCTTACGCTTCAACGATAGCATAGACATATAG
Transcript >Ophcf2|01561
ATGCAATTCGGCAAGCATATCCAGAAGCGTCAGCTCGAGATCCCCGAGTATTGCGCCAGCTTCGTCAACTACAAG
GCCCTCAAAAAGCTCATCAAGAAGCTGTCCGCCACGCCGACGCTGCCCGCCCTAGATGACGCCAATCGTCCGTCG
GCAGCCGGCGCCTCCTCCCAGTCTGCCCTTCAGGCTAACAAGGCCACCTTCTTTTTCCAGCTGGAGCGAGAGCTC
GACAAGGTGAATGCCTTTTACTTGCAAAAGGAAGCCGAGCTCAAGATCCGGCTCAAGACGCTGCTTGACAAGAAA
AAGGTGCTGCAGACGCGTCCCGATGTCCCTCGGCGGTCCTCCAAGTTTACCACTCTCGAGGAGGGCTTTCAGCAG
TTCGCCACGGACCTGAATAAGCTGCAGCACTTCGTCGACATCAACGGCACCGCCTTTTCCAAGATTCTCAAGAAG
TGGGACAAGACATCCAAGTCCAGGACCAAGGAACTCTATCTGTCCCGCGCCGTCGAGGTTCAGCCCTTCTTCAAC
GCCCCCGTCATCAGCGAGCTGTCGGACCAGGTCACCACCAGCTTACAGGAGCTGGGTGCCTGGTCCGACGGAATC
CAGGTCAACTTCAACGCCTCGGGCCACGTCGTGCCCAGTCAGCACTTTGACGAGGCTGATGCCGATACGCTCTTG
TTCGACACTGTCGTCTCCGGCAACCTCGAGTCGTTGAGCGATCTCCTGGCCAAGACGCGCGACGGCGAGAGCCCC
ATGACGGATCGAGTCACCCGCACCTTTCTGACGGCCGTACACGATGCACCGCGCGAGTCGCTGCAGATGCTGCTC
GATACGGGCCTCGTCGACCTGCACTCGTACGACGACATCAATGAGCGCAACTGCCTGCACCAGGCCGCCATCTAT
GGCAAGCAGCACGTGCTGGAATGGGGCCTGAAAGCCGCCGTCGCCGTCGACCGAACCGATGTCTACGGACGGGCG
CCTCTGCACTACACCAGCCAACACGGCCGGCTGGAGATGCTGGAGATGCTGCTGGATGCCGATCCCCGGACGATA
GACCTGGCTGATCACGACAACTTTACACCGCTGATCCACGCCATCCGCCACGGCCACCTCGACTGCGTCCAGCGC
CTCGTAGCCCGTTCAGCACGTATCGACCCCGTGCCGGACGCGGGCCATGCGCCCCTGAACCTGGCCTGCGAACGC
GCGTCGGAGCCGGTGGTGGAGCTCCTGTTGCGTCACGGCGCCCAGATGCTACCGGACGCCGAGGGCCTGTATCCC
CAGCACCTGGTGGCCCGGTCCGGCAAGTCGTCCAACCTGCTGCTGCTTCTGAAGCAGTACGGCGCCGACCTGGAC
CAGGCCGACAAGCTCTACGGCTGGACGCCGCTGGTGCACGCCGCCAGCGAAGGCAACGTCGACTGCCTGCAGACG
CTGCTCCGGATCGGCGTCGACGCCCACGTCGTGGACGAAAAGGGTTTGCCAGCCATGTACTACGCCGCCTGGGAA
GGCCACCTCGAATGCATGAAGCTCCTGTCGCCGCTGGACGGGCAGAGCAGCAGCAGGATCGGTCCGCTCGTCGGC
AAGCCTTCGCCGGCAGCGGCCGCTCCGGTGCCCATGGCGCTGGATCCCGACGGCATCCCGGAGCTGGAGCTGCCG
CCGCCCATCATCCCGCTCCGGCGCTACGGTCACAACTTCCTCGACACCAAGACGGTGGTGCAGATCAGCTTCGAC
GAGGCTCAGGGGCCGGCTCTCGTCTTCTTCCAGGACGGCAAGTATCCGGCTGCGCGACTGACCATCTCGTCCAAG
CTATCGGGCCTCATCCCAAAGAACATCATTCTTCCCTTTCAAGAGGACACGCGAAACGTGTCCTTCCAAGTCGAT
AACATCGACTCCTTCTCCCTCGATCTAGATGTGTTCCCGACGTACGGGGCCAAGGTCATCGCCCGGACGGTGGCG
CTGCCGAGCGTGCTGGGGCCACACCAGGGCAGCTCGAGCAGCTGCCTGCCGCTGTTTGACCCTCGATTGCGGGCC
ATCGGACAGATCAGCTTCACGGCGGATGTGATCCGGCCCTTTCAAGGACACTCGCTGGAGATTGCCGACTTCGAG
ACGTACTGGAAGGCTACGAGCCAGCTGGACCAGCCGACGAGCGCCGTGGTCACAGGGTCGAGCCTCTGCGGGGAC
TACGTCCGGTTGCCGGTGCAGCACACGGGCGACGGGGTGCCGGTCGTTTGGTCGCGGTGGACGGTGACCTGCGGC
GGCGGTATCGATTTGCCCGTGTGCCGGCTTTCACTGAAACAGTTTCGGGCCTTGGCCGGGCGGCGGGCCGAGATT
CCGGCAGTGGCTCCGACAGCGACGGCCGACGAGGTCGCCGGCATGTTCCGGACCGGGGAGGCGGCGGGGGCAACG
CTCGCCGAGGCACTGGCGGTGCTGCCACCGGCGGTACACGTCAATCTCCAGGTGCTGCACCCGACGGCCGACCAG
GAGAGGACTCTCGGGCTCGGCCCGGCCCTTGACGTCAACCCGTCGGTCGACTCGATCCTCGCCGACGTCTTTGAA
GACGCGCGCGCGCAGAGGGCACAGCGCCGGCCGCCCGACGGGGCGCGTTCGGTGGTCTTTAGCAGCTATAGCGCC
AGGGTCTGCGCCGCTCTCAACTGGAAGCAGCCCAACTTTCCCGTCTTTCTGTGCAATGACCTCGGCCGGGAGCCC
GATTCGGGTCTGGACGCGGCCAGGAGGAGTACGTCCATCAAGGAGGCGGTGCGCATCGCCCAGAGCAACAATCTT
ATGGGGCTCATGTGCTTCGGGCGCCTGCTGGAGATGGTGCCGGCACTCGTGGATGCCATCAAGTCGCATGGACTC
GCCCTTGTCACAGATAAGTCAACGGATGCTTCGTCTAGTGACTCGTCCTCGCAGGTGCCCAAGGGCGTCGACGGC
GTGCTCCGTCATCATGGTATCTTACGCTTCAACGATAGCATAGACATATAG
Gene >Ophcf2|01561
ATGCAAGTGGCATCGGCGTCTCCGCCCCGTACAAGCCTCAGCCTGCTGATCAGCCAGCCGCAGGAAGTTCGGCAA
GCATATCCAGAAGCGTCAGCTCGAGATCCCCGAGTATTGCGCCAGCTTCGTCAACTACAAGGCCCTCAAAAAGGC
TCGTACTGGACCCCTTCCCCCGGGACCAATCATGGCGCTGACCCTGTCACCCTGTCACCCTGTCACCCTGTCGAT
ATAGCTCATCAAGAAGCTGTCCGCCACGCCGACGCTGCCCGCCCTAGATGACGCCAATCGTCCGTCGGCAGCCGG
CGCCTCCTCCCAGTCTGCCCTTCAGGCTAACAAGGCCACCTTCTTTTTCCAGCTGGTCGGTATCCGCGGCTGAAT
CTTGTGGGGGCCCCGGTGCTGATGGAAATCCGGTTACAGGAGCGAGAGCTCGACAAGGTGAATGCCTTTTACTTG
CAAAAGGAAGCCGAGGTTCGTCTCGTCCCGTTGGCCCCATCGTCAAAGGGTCCGTGCCGACTCGGAGCAGCTCAA
GATCCGGCTCAAGACGCTGCTTGACAAGAAAAAGGTGCTGCAGACGCGTCCCGATGTCCCTCGGCGGTCCTCCAA
GTTTACCACTCTCGAGGAGGGCTTTCAGCAGTTCGCCACGGACCTGAATAAGCTGCAGCACTTCGTCGACATCAA
CGGCACCGCCTTTTCCAAGATTCTCAAGAAGTGGGACAAGACATCCAAGTCCAGGACCAAGGAACTCTATCTGTC
CCGCGCCGTCGAGGTTCAGCCCTTCTTCAACGCCCCCGTCATCAGCGAGCTGTCGGACCAGGTCACCACCAGCTT
ACAGGAGCTGGGTGCCTGGTCCGACGGAATCCAGGTCAACTTCAACGCCTCGGGCCACGTCGTGCCCAGTCAGCA
CTTTGACGAGGCTGATGCCGATACGCTCTTGTTCGACACTGTCGTCTCCGGCAACCTCGAGTCGTTGAGCGATCT
CCTGGCCAAGACGCGCGACGGCGAGAGCCCCATGACGGATCGAGTCACCCGCACCTTTCTGACGGCCGTACACGA
TGCACCGCGCGAGTCGCTGCAGATGCTGCTCGATACGGGCCTCGTCGACCTGCACTCGTACGACGACATCAATGA
GCGCAACTGCCTGCACCAGGCCGCCATCTATGGCAAGCAGCACGTGCTGGAATGGGGCCTGAAAGCCGCCGTCGC
CGTCGACCGAACCGATGTCTACGGACGGGCGCCTCTGCACTACACCAGCCAACACGGCCGGCTGGAGATGCTGGA
GATGCTGCTGGATGGTGAGTCGCTCGCCCGTCGGCGGAGAGTCGGCTGACGAGACCCATCCGAAGCCGATCCCCG
GACGATAGACCTGGCTGATCACGACAACTTTACACCGCTGATCCACGCCATCCGCCACGGCCACCTCGACTGCGT
CCAGCGCCTCGTAGCCCGTTCAGCACGTATCGACCCCGTGCCGGACGCGGGCCATGCGCCCCTGAACCTGGCCTG
CGAACGCGCGTCGGAGCCGGTGGTGGAGCTCCTGTTGCGTCACGGCGCCCAGATGCTACCGGACGCCGAGGGCCT
GTATCCCCAGCACCTGGTGGCCCGGTCCGGCAAGTCGTCCAACCTGCTGCTGCTTCTGAAGCAGTACGGCGCCGA
CCTGGACCAGGCCGACAAGCTCTACGGCTGGACGCCGCTGGTGCACGCCGCCAGCGAAGGCAACGTCGACTGCCT
GCAGACGCTGCTCCGGATCGGCGTCGACGCCCACGTCGTGGACGAAAAGGGTTTGCCAGCCATGTACTACGCCGC
CTGGGAAGGCCACCTCGAATGCATGAAGCTCCTGTCGCCGCTGGACGGGCAGAGCAGCAGCAGGATCGGTCCGCT
CGTCGGCAAGCCTTCGCCGGCAGCGGCCGCTCCGGTGCCCATGGCGCTGGATCCCGACGGCATCCCGGAGCTGGA
GCTGCCGCCGCCCATCATCCCGCTCCGGCGCTACGGTCACAACTTCCTCGACACCAAGACGGTGGTGCAGATCAG
CTTCGACGAGGCTCAGGGGCCGGCTCTCGTCTTCTTCCAGGACGGCAAGTATCCGGCTGCGCGACTGACCATCTC
GTCCAAGCTATCGGGCCTCATCCCAAAGAACATCATTCTTCCCTTTCAAGAGGACACGCGAAACGTGTCCTTCCA
AGTCGATAACATCGACTCCTTCTCCCTCGATCTAGATGTGTTCCCGACGTACGGGGCCAAGGTCATCGCCCGGAC
GGTGGCGCTGCCGAGCGTGCTGGGGCCACACCAGGGCAGCTCGAGCAGCTGCCTGCCGCTGTTTGACCCTCGATT
GCGGGCCATCGGACAGATCAGCTTCACGGCGGATGTGATCCGGCCCTTTCAAGGACACTCGCTGGAGATTGCCGA
CTTCGAGACGTACTGGAAGGCTACGAGCCAGCTGGACCAGCCGACGAGCGCCGTGGTCACAGGGTCGAGCCTCTG
CGGGGACTACGTCCGGTTGCCGGTGCAGCACACGGGCGACGGGGTGCCGGTCGTTTGGTCGCGGTGGACGGTGAC
CTGCGGCGGCGGTATCGATTTGCCCGTGTGCCGGCTTTCACTGAAACAGTTTCGGGCCTTGGCCGGGCGGCGGGC
CGAGATTCCGGCAGTGGCTCCGACAGCGACGGCCGACGAGGTCGCCGGCATGTTCCGGACCGGGGAGGCGGCGGG
GGCAACGCTCGCCGAGGCACTGGCGGTGCTGCCACCGGCGGTACACGTCAATCTCCAGGTGCTGCACCCGACGGC
CGACCAGGAGAGGACTCTCGGGCTCGGCCCGGCCCTTGACGTCAACCCGTCGGTCGACTCGATCCTCGCCGACGT
CTTTGAAGACGCGCGCGCGCAGAGGGCACAGCGCCGGCCGCCCGACGGGGCGCGTTCGGTGGTCTTTAGCAGCTA
TAGCGCCAGGGTCTGCGCCGCTCTCAACTGGAAGCAGCCCAACTTTCCCGTCTTTCTGTGCAATGACCTCGGCCG
GGAGCCCGATTCGGGTCTGGACGCGGCCAGGAGGAGTACGTCCATCAAGGAGGCGGTGCGCATCGCCCAGAGCAA
CAATCTTATGGGGCTCATGTGCTTCGGGCGCCTGCTGGTATCGTGTCCCTCTCTTCTGAACCTTGTTTGACTCGA
CTTTTTCGGCTGACGGAGATCATGGCAGGAGATGGTGCCGGCACTCGTGGATGCCATCAAGTCGCATGGACTCGC
CCTTGTCACAGATAAGTCAACGGATGCTTCGTCTAGTGACTCGTCCTCGCAGGTGCCCAAGGGCGTCGACGGCGT
GCTCCGTCATCATGGTATCTTACGCTTCAACGATAGCATAGACATATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail