Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01557
Gene name
Locationscaffold_01:5322994..5324362
Strand-
Gene length (bp)1368
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 224 246 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 127.33 71.26 183.40
Alive In ants, during behavior modification 68.68 37.88 99.48
Dead In ants, recently dead 112.46 62.08 162.84

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000454 yes
Alive Dead 0.001945 yes
Dead Fungus 0.574632 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01557
MPPEPEPDINGANRSEAFQDKRPSRLADLNMSAPTSQAPTSVVESASTPSADHAAASSAVALPAAASSSSTPSNP
PPAASASTRAAPLPSSSSPSSSPVPLPTQQAPPLVPSSSSSTTTPLQHASMATPTSAPTQPSSSSSPPVAVVPSS
SSPQPEASSTVITVTSSNVATSVQVVTSTKTHAPVGGLSSSTATSSSPSSTSSAAAAAIETPSSATGLTQASKVA
IGVVVPIAAIAFLAIVGLFWWKKRRARQEVEEQRRKEVEDYSYNPNADPTMPAVGHTVEHAYEAKDDGGYRGWGS
TATTTGSGRGRKASTTMSGGAAGTYSDPASPVRANMSDARSGEALVDGSPTHEGEILGAMGPSAANNRGGDMRRG
PSNASSSYSAAARSDGSDGAMYGNGAAGYYEQCGQNPYEQRPNDQGGGQAVIRDNPARRNTRIENSSHYPQQSAG
IAQNF*
Coding >Ophcf2|01557
ATGCCACCCGAGCCGGAGCCGGACATCAATGGCGCTAACAGGAGTGAGGCATTCCAGGACAAGAGGCCATCTCGT
CTCGCCGACTTGAACATGTCGGCTCCCACGAGCCAGGCCCCGACGTCCGTCGTTGAGAGCGCCTCGACGCCTTCG
GCTGATCATGCCGCTGCTTCTTCTGCCGTTGCTCTTCCCGCTGCCGCCTCGTCCTCGTCTACCCCTTCCAATCCG
CCGCCTGCCGCCAGTGCCAGCACTCGAGCCGCTCCTTTGCCCTCCAGCTCATCACCGTCGTCGTCGCCAGTACCT
TTGCCCACGCAACAGGCGCCGCCTCTTGTTCCTTCGTCCAGCTCATCAACGACGACGCCTCTCCAGCATGCCTCT
ATGGCAACCCCGACTTCAGCCCCGACTCAGCCTTCTTCGTCCTCGTCTCCTCCCGTCGCCGTCGTCCCCTCGTCA
TCCTCCCCGCAGCCCGAGGCTTCTTCGACCGTCATCACCGTGACATCCAGCAATGTGGCCACAAGTGTACAGGTC
GTGACGTCGACCAAGACGCATGCCCCCGTCGGCGGGCTATCATCGTCGACGGCGACGTCGTCCTCGCCCTCGTCC
ACCTCGTCCGCCGCCGCCGCCGCCATCGAAACCCCCAGCTCTGCCACAGGCCTTACACAGGCGTCAAAGGTGGCC
ATTGGCGTCGTGGTGCCCATCGCCGCCATCGCCTTTCTAGCCATCGTCGGTCTTTTCTGGTGGAAGAAGCGGAGG
GCGCGTCAGGAGGTCGAGGAGCAACGCCGTAAGGAGGTCGAGGATTACTCGTACAACCCCAACGCGGACCCGACC
ATGCCCGCCGTCGGCCACACGGTCGAGCACGCCTACGAGGCCAAGGACGACGGCGGATACCGCGGCTGGGGCTCG
ACGGCCACCACCACGGGCTCCGGCAGGGGACGCAAGGCCTCGACCACCATGTCCGGGGGCGCGGCCGGCACCTAC
TCGGATCCGGCGTCGCCCGTGCGGGCCAACATGTCGGACGCTCGTTCGGGCGAGGCTCTCGTCGACGGCTCGCCG
ACGCACGAGGGCGAGATTCTGGGCGCCATGGGCCCGTCGGCGGCCAATAACCGCGGCGGCGACATGCGCAGGGGC
CCGTCCAACGCCTCTTCGTCTTACAGCGCGGCCGCCAGGTCTGACGGCTCCGACGGCGCCATGTACGGCAACGGG
GCGGCCGGCTATTACGAGCAGTGCGGCCAGAACCCCTACGAACAGCGACCCAACGACCAGGGCGGTGGCCAGGCC
GTCATCCGTGACAATCCGGCCCGACGCAACACGCGCATCGAGAATTCGTCTCACTACCCGCAGCAGAGCGCTGGC
ATTGCTCAGAACTTTTGA
Transcript >Ophcf2|01557
ATGCCACCCGAGCCGGAGCCGGACATCAATGGCGCTAACAGGAGTGAGGCATTCCAGGACAAGAGGCCATCTCGT
CTCGCCGACTTGAACATGTCGGCTCCCACGAGCCAGGCCCCGACGTCCGTCGTTGAGAGCGCCTCGACGCCTTCG
GCTGATCATGCCGCTGCTTCTTCTGCCGTTGCTCTTCCCGCTGCCGCCTCGTCCTCGTCTACCCCTTCCAATCCG
CCGCCTGCCGCCAGTGCCAGCACTCGAGCCGCTCCTTTGCCCTCCAGCTCATCACCGTCGTCGTCGCCAGTACCT
TTGCCCACGCAACAGGCGCCGCCTCTTGTTCCTTCGTCCAGCTCATCAACGACGACGCCTCTCCAGCATGCCTCT
ATGGCAACCCCGACTTCAGCCCCGACTCAGCCTTCTTCGTCCTCGTCTCCTCCCGTCGCCGTCGTCCCCTCGTCA
TCCTCCCCGCAGCCCGAGGCTTCTTCGACCGTCATCACCGTGACATCCAGCAATGTGGCCACAAGTGTACAGGTC
GTGACGTCGACCAAGACGCATGCCCCCGTCGGCGGGCTATCATCGTCGACGGCGACGTCGTCCTCGCCCTCGTCC
ACCTCGTCCGCCGCCGCCGCCGCCATCGAAACCCCCAGCTCTGCCACAGGCCTTACACAGGCGTCAAAGGTGGCC
ATTGGCGTCGTGGTGCCCATCGCCGCCATCGCCTTTCTAGCCATCGTCGGTCTTTTCTGGTGGAAGAAGCGGAGG
GCGCGTCAGGAGGTCGAGGAGCAACGCCGTAAGGAGGTCGAGGATTACTCGTACAACCCCAACGCGGACCCGACC
ATGCCCGCCGTCGGCCACACGGTCGAGCACGCCTACGAGGCCAAGGACGACGGCGGATACCGCGGCTGGGGCTCG
ACGGCCACCACCACGGGCTCCGGCAGGGGACGCAAGGCCTCGACCACCATGTCCGGGGGCGCGGCCGGCACCTAC
TCGGATCCGGCGTCGCCCGTGCGGGCCAACATGTCGGACGCTCGTTCGGGCGAGGCTCTCGTCGACGGCTCGCCG
ACGCACGAGGGCGAGATTCTGGGCGCCATGGGCCCGTCGGCGGCCAATAACCGCGGCGGCGACATGCGCAGGGGC
CCGTCCAACGCCTCTTCGTCTTACAGCGCGGCCGCCAGGTCTGACGGCTCCGACGGCGCCATGTACGGCAACGGG
GCGGCCGGCTATTACGAGCAGTGCGGCCAGAACCCCTACGAACAGCGACCCAACGACCAGGGCGGTGGCCAGGCC
GTCATCCGTGACAATCCGGCCCGACGCAACACGCGCATCGAGAATTCGTCTCACTACCCGCAGCAGAGCGCTGGC
ATTGCTCAGAACTTTTGA
Gene >Ophcf2|01557
ATGCCACCCGAGCCGGAGCCGGACATCAATGGCGCTAACAGGAGTGAGGCATTCCAGGACAAGAGGCCATCTCGT
CTCGCCGACTTGAACATGTCGGCTCCCACGAGCCAGGCCCCGACGTCCGTCGTTGAGAGCGCCTCGACGCCTTCG
GCTGATCATGCCGCTGCTTCTTCTGCCGTTGCTCTTCCCGCTGCCGCCTCGTCCTCGTCTACCCCTTCCAATCCG
CCGCCTGCCGCCAGTGCCAGCACTCGAGCCGCTCCTTTGCCCTCCAGCTCATCACCGTCGTCGTCGCCAGTACCT
TTGCCCACGCAACAGGCGCCGCCTCTTGTTCCTTCGTCCAGCTCATCAACGACGACGCCTCTCCAGCATGCCTCT
ATGGCAACCCCGACTTCAGCCCCGACTCAGCCTTCTTCGTCCTCGTCTCCTCCCGTCGCCGTCGTCCCCTCGTCA
TCCTCCCCGCAGCCCGAGGCTTCTTCGACCGTCATCACCGTGACATCCAGCAATGTGGCCACAAGTGTACAGGTC
GTGACGTCGACCAAGACGCATGCCCCCGTCGGCGGGCTATCATCGTCGACGGCGACGTCGTCCTCGCCCTCGTCC
ACCTCGTCCGCCGCCGCCGCCGCCATCGAAACCCCCAGCTCTGCCACAGGCCTTACACAGGCGTCAAAGGTGGCC
ATTGGCGTCGTGGTGCCCATCGCCGCCATCGCCTTTCTAGCCATCGTCGGTCTTTTCTGGTGGAAGAAGCGGAGG
GCGCGTCAGGAGGTCGAGGAGCAACGCCGTAAGGAGGTCGAGGATTACTCGTACAACCCCAACGCGGACCCGACC
ATGCCCGCCGTCGGCCACACGGTCGAGCACGCCTACGAGGCCAAGGACGACGGCGGATACCGCGGCTGGGGCTCG
ACGGCCACCACCACGGGCTCCGGCAGGGGACGCAAGGCCTCGACCACCATGTCCGGGGGCGCGGCCGGCACCTAC
TCGGATCCGGCGTCGCCCGTGCGGGCCAACATGTCGGACGCTCGTTCGGGCGAGGCTCTCGTCGACGGCTCGCCG
ACGCACGAGGGCGAGATTCTGGGCGCCATGGGCCCGTCGGCGGCCAATAACCGCGGCGGCGACATGCGCAGGGGC
CCGTCCAACGCCTCTTCGTCTTACAGCGCGGCCGCCAGGTCTGACGGCTCCGACGGCGCCATGTACGGCAACGGG
GCGGCCGGCTATTACGAGCAGTGCGGCCAGAACCCCTACGAACAGCGACCCAACGACCAGGGCGGTGGCCAGGCC
GTCATCCGTGACAATCCGGCCCGACGCAACACGCGCATCGAGAATTCGTCTCACTACCCGCAGCAGAGCGCTGGC
ATTGCTCAGAACTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail