Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01555
Gene name
Locationscaffold_01:5314615..5316064
Strand+
Gene length (bp)1449
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 2.4E-07 5 115
PF00135 COesterase Carboxylesterase family 6.9E-10 123 252

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6727 0.4995 0.4964 0.0097 0.352 0.1024 0.186 0.0496 0.0635 0.5243

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6360
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|245
Ophiocordyceps australis map64 (Brazil) OphauB2|2421
Ophiocordyceps camponoti-floridani Ophcf2|01555 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3658
Ophiocordyceps kimflemingae Ophio5|1466

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01555
MSSSETVVSINGGNIIGRHQSPSADRPQALDVFHDIVYARTPTRFQPAEAIPPVSPGETVRADRCPGPSQPQVLA
EGIRQEGDVRLHVMRTCRCSDGKLLPVVVYLHGGGFNFGGPLERDFGGAGAHSIGHHLVSPLPLPLPVRKAILES
GAPTARSVLSAAHPRPVGQLASLRRHLGASYLSQAPLDALLSAAGSVWAENATAVTWPFQPVVDGNLIPDLPCRL
VRGVSDGVALLTGFCSHEGAGFLERGEDFKAFFGNLIPGIDMVGLEELYPADMMTTTVTRAQLAYGDYAYIAPVL
HTACCLARAGARVYVYEYSAAAAPLSAASHGDHMAVSACEADMLRGRPGLAAVGSAMAERWTAFAARE*
Coding >Ophcf2|01555
ATGTCATCGTCAGAGACGGTCGTCTCCATCAACGGCGGAAACATCATCGGACGCCACCAGTCTCCTTCAGCAGAC
CGCCCACAGGCCCTAGACGTCTTCCACGACATCGTCTACGCCAGAACACCTACGCGCTTCCAGCCAGCAGAGGCG
ATCCCACCCGTGTCTCCGGGCGAGACAGTGCGCGCGGACCGATGCCCGGGTCCGAGCCAGCCGCAGGTGCTGGCC
GAGGGCATCCGCCAAGAGGGAGATGTCCGTCTCCATGTGATGCGGACTTGCCGATGCTCCGACGGGAAGCTTCTT
CCGGTGGTTGTGTACCTGCACGGCGGGGGGTTCAACTTTGGGGGACCGTTGGAGAGGGATTTCGGGGGTGCGGGA
GCGCATTCTATCGGACACCATCTCGTTTCTCCCCTCCCTCTCCCCCTGCCAGTCCGCAAAGCCATCCTCGAGTCC
GGAGCCCCAACAGCGCGGTCGGTGCTATCAGCTGCACACCCCCGTCCGGTAGGCCAGCTCGCCTCCCTCCGCCGG
CATCTCGGCGCCTCGTACCTCAGCCAAGCGCCGCTCGATGCCCTCCTCTCGGCCGCCGGCAGCGTATGGGCCGAA
AACGCGACGGCCGTGACCTGGCCGTTTCAACCTGTCGTCGACGGCAACCTCATCCCGGACTTGCCGTGCCGGTTG
GTGCGCGGCGTGAGCGATGGCGTTGCTCTGCTTACGGGATTTTGCTCGCATGAGGGTGCGGGCTTCCTGGAGAGG
GGAGAGGACTTTAAGGCTTTCTTTGGGAATCTCATTCCGGGGATTGACATGGTTGGTCTTGAGGAGCTTTATCCG
GCTGATATGATGACGACGACGGTGACGCGCGCGCAGCTTGCGTACGGAGACTATGCTTACATCGCTCCCGTGTTG
CATACAGCCTGCTGTCTTGCCCGGGCCGGGGCTCGGGTCTACGTGTACGAGTACAGCGCGGCTGCTGCACCTCTC
TCGGCCGCCTCGCACGGCGATCACATGGCCGTCTCCGCGTGCGAAGCCGACATGCTACGGGGCCGGCCGGGGCTC
GCTGCCGTGGGATCCGCCATGGCGGAGCGGTGGACGGCGTTTGCGGCGAGGGAATGA
Transcript >Ophcf2|01555
ATGTCATCGTCAGAGACGGTCGTCTCCATCAACGGCGGAAACATCATCGGACGCCACCAGTCTCCTTCAGCAGAC
CGCCCACAGGCCCTAGACGTCTTCCACGACATCGTCTACGCCAGAACACCTACGCGCTTCCAGCCAGCAGAGGCG
ATCCCACCCGTGTCTCCGGGCGAGACAGTGCGCGCGGACCGATGCCCGGGTCCGAGCCAGCCGCAGGTGCTGGCC
GAGGGCATCCGCCAAGAGGGAGATGTCCGTCTCCATGTGATGCGGACTTGCCGATGCTCCGACGGGAAGCTTCTT
CCGGTGGTTGTGTACCTGCACGGCGGGGGGTTCAACTTTGGGGGACCGTTGGAGAGGGATTTCGGGGGTGCGGGA
GCGCATTCTATCGGACACCATCTCGTTTCTCCCCTCCCTCTCCCCCTGCCAGTCCGCAAAGCCATCCTCGAGTCC
GGAGCCCCAACAGCGCGGTCGGTGCTATCAGCTGCACACCCCCGTCCGGTAGGCCAGCTCGCCTCCCTCCGCCGG
CATCTCGGCGCCTCGTACCTCAGCCAAGCGCCGCTCGATGCCCTCCTCTCGGCCGCCGGCAGCGTATGGGCCGAA
AACGCGACGGCCGTGACCTGGCCGTTTCAACCTGTCGTCGACGGCAACCTCATCCCGGACTTGCCGTGCCGGTTG
GTGCGCGGCGTGAGCGATGGCGTTGCTCTGCTTACGGGATTTTGCTCGCATGAGGGTGCGGGCTTCCTGGAGAGG
GGAGAGGACTTTAAGGCTTTCTTTGGGAATCTCATTCCGGGGATTGACATGGTTGGTCTTGAGGAGCTTTATCCG
GCTGATATGATGACGACGACGGTGACGCGCGCGCAGCTTGCGTACGGAGACTATGCTTACATCGCTCCCGTGTTG
CATACAGCCTGCTGTCTTGCCCGGGCCGGGGCTCGGGTCTACGTGTACGAGTACAGCGCGGCTGCTGCACCTCTC
TCGGCCGCCTCGCACGGCGATCACATGGCCGTCTCCGCGTGCGAAGCCGACATGCTACGGGGCCGGCCGGGGCTC
GCTGCCGTGGGATCCGCCATGGCGGAGCGGTGGACGGCGTTTGCGGCGAGGGAATGA
Gene >Ophcf2|01555
ATGTCATCGTCAGAGACGGTCGTCTCCATCAACGGCGGAAACATCATCGGACGCCACCAGTCTCCTTCAGCAGAC
CGCCCACAGGCCCTAGACGTCTTCCACGACATCGTCTACGCCAGAACACCTACGCGCTTCCAGCCAGCAGAGGCG
ATCCCACCCGTGTCTCCGGGCGAGACAGTGCGCGCGGACCGATGCCCGGGTCCGAGCCAGCCGCAGGTGCTGGCC
GAGGGCATCCGCCAAGAGGGAGATGTCCGTCTCCATGTGATGCGGACTTGCCGATGCTCCGACGGGAAGCTTCTT
CCGGTGGTTGTGTACCTGCACGGCGGGGGGTTCAACTTTGGGGGACCGTTGGAGAGGGATTTCGGGGGGTGGGTT
GCTCGTTCTGGGGGGGTGGTGGTTTTCATGCTTGAGTATCGGCTCGGGGTCTTGGGGTTTGGCCGGGGGGGAATG
TTGGGCTTTGGGATCAGAGGGTTGGCATGAAGTGGGTTGGGGATTGGGGGGTGAGTTTGGGGGGATGTTGGGAAT
GTCACTCTCATGGGTGTCAGTGCGGGAGCGCATTCTGTGAGTTTCTCTTCTGTCTACCAGGAGGGGGGAATATAC
TGACGCTTTCTAGATCGGACACCATCTCGTTTCTCCCCTCCCTCTCCCCCTGCCAGTCCGCAAAGCCATCCTCGA
GTCCGGAGCCCCAACAGCGCGGTCGGTGCTATCAGCTGCACACCCCCGTCCGGTAGGCCAGCTCGCCTCCCTCCG
CCGGCATCTCGGCGCCTCGTACCTCAGCCAAGCGCCGCTCGATGCCCTCCTCTCGGCCGCCGGCAGCGTATGGGC
CGAAAACGCGACGGCCGTGACCTGGCCGTTTCAACCTGTCGTCGACGGCAACCTCATCCCGGACTTGCCGTGCCG
GTTGGTGCGCGGCGTGAGCGATGGCGTTGCTCTGCTTACGGGATTTTGCTCGCATGAGGGTGCGGGCTTCCTGGA
GAGGGGAGAGGACTTTAAGGCTTTCTTTGGGAATCTCATTCCGGGGATTGACATGGTTGGTCTTGAGGAGCTTTA
TCCGGCTGATATGATGACGACGACGGTGACGCGCGCGCAGCTTGCGTACGGAGACTATGCTTACATCGCTCCCGT
GTTGCATACAGCCTGCTGTCTTGCCCGGGCCGGGGCTCGGGTCTACGTGTACGAGTACAGCGCGGCTGCTGCACC
TCTCTCGGCCGCCTCGCACGGCGATCACATGGCCGTCTCCGCGTGCGAAGCCGACATGCTACGGGGCCGGCCGGG
GCTCGCTGCCGTGGGATCCGCCATGGCGGAGCGGTGGACGGCGTTTGCGGCGAGTGAGCGGGGGGTTTTGGACGA
AGCGGTTTGGCCTGCTTTTCGACCTTTTCCCGAGGAGGAGGAGGGAGGGGATGGGGGTGAGAGGGCTGGGGAGGT
GCTTGTTTTTGGGCAGGGGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail