Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01550
Gene name
Locationscaffold_01:5303731..5307005
Strand-
Gene length (bp)3274
Transcript length (bp)2199
Coding sequence length (bp)2199
Protein length (aa) 733

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 631 653 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 2.09 0.55 3.63
Alive In ants, during behavior modification 1.75 0.36 3.14
Dead In ants, recently dead 5.63 2.10 9.17

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.642597 no
Alive Dead 0.000238 yes
Dead Fungus 0.000657 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01550
MKPTLLLLASFVPSALALVSHTWSFNNAPAEGFDDITFPMNIAEAPHKVGFYFAEQFDFYKVRKPAYIGLQPQAD
GANGQPMIRAVFSTFQGESKTADKNCKLGADDGPGVSCAVTVPASYKDTYHLKVQHVSGTTWRGLLINNSTGGNE
IRIGQWTLPNGAGKVKKFQAGFVEYFPWNSPRRHLCSDLPKTKVTFGFPFTSSIEEQGIIAKPTEDGDSSSLYSL
SLTTDFPVERPIPQSLLENTTIKHRSTLAHASASLPDGLVLWNTPDTIYAFGSGGRGRSDQIAAYDVNSRNWRDV
KVKGGDFNSGRRTGAQYVSVPGSDLHFVYGGTAPYGGGMLRFDSKKLSWTNETLGRGSFGVPVPGLDNGVLVYVP
AGREGMLISFGGANVTAGIKPGWGRSYDSDWHIIYVYDIASHTWWSQRATGKPPSGRGSFCTSVTTAPDNGAFHI
TTYGGWSRTNNRAYEDVHVLSIPSFTWIDATALSDRSNAEQQVNSTIGRDRLSGSCQTLNGRQMVVVGGEIRSGA
LPLTEASCDDDFEPVRILDLSTYEWQWELQDGRDSYRVPSVIYERIGGGASGGATVTAPQRGFADATLSSLLQLR
VSTAVGNSPSSHRSTGWGSEDSGKGIGAGAVAGAVLGAIGGLVALAGFTWFLLRKRQERRKKKKKKKKKKKKKEK
KMREDGEEEAGIRQEDREPQEMESIDLTSPGSLVSPHSMASPKPSEADGREVYELPI*
Coding >Ophcf2|01550
ATGAAGCCCACCCTCCTCTTGCTCGCTTCCTTCGTGCCCTCGGCTCTCGCCCTCGTCAGTCACACATGGTCCTTC
AACAACGCACCGGCCGAAGGCTTCGATGACATCACCTTCCCCATGAACATCGCCGAGGCACCACACAAGGTCGGC
TTCTACTTTGCTGAGCAGTTCGACTTTTACAAGGTCCGCAAGCCGGCATACATCGGGCTGCAGCCCCAAGCCGAC
GGCGCCAACGGCCAGCCCATGATCCGCGCCGTCTTTTCCACTTTCCAGGGAGAGTCCAAGACGGCGGATAAGAAC
TGCAAACTCGGCGCCGATGACGGTCCTGGAGTCAGCTGCGCCGTCACGGTCCCTGCCAGCTACAAGGACACATAT
CATCTCAAGGTCCAGCATGTTTCGGGGACTACATGGAGAGGTTTGCTCATCAACAACTCGACGGGCGGCAACGAG
ATCCGGATCGGGCAGTGGACGCTCCCCAACGGAGCAGGGAAGGTGAAAAAGTTTCAGGCCGGCTTCGTCGAATAC
TTCCCGTGGAACTCGCCTCGTCGGCATCTATGCTCCGATCTGCCCAAGACAAAGGTCACTTTCGGCTTCCCGTTC
ACCAGCAGCATCGAGGAGCAGGGCATTATCGCCAAGCCTACCGAAGACGGGGACTCCTCATCTCTCTACTCACTC
TCCCTCACCACCGACTTCCCCGTCGAACGTCCAATCCCCCAATCCCTCCTCGAAAACACCACCATCAAGCACCGC
TCAACCCTCGCCCACGCAAGCGCCTCCCTCCCAGACGGCCTCGTGCTCTGGAACACACCCGACACCATCTACGCC
TTCGGCAGCGGCGGCCGCGGGAGAAGCGATCAGATAGCAGCCTACGACGTCAACAGCCGCAACTGGAGGGACGTC
AAGGTCAAGGGCGGAGACTTTAACTCTGGGCGCCGCACCGGCGCGCAGTATGTCAGTGTTCCGGGCTCGGATCTT
CACTTTGTTTATGGAGGGACGGCGCCTTATGGGGGGGGGATGCTGCGGTTCGACTCCAAGAAGTTATCGTGGACC
AACGAGACGCTCGGGCGTGGCTCGTTTGGGGTGCCGGTTCCGGGGCTTGACAATGGTGTCTTGGTCTATGTTCCC
GCTGGAAGGGAGGGGATGCTCATCAGCTTTGGCGGTGCCAACGTGACGGCAGGTATAAAGCCTGGCTGGGGCCGG
TCTTACGACTCCGACTGGCACATCATCTACGTCTACGACATCGCCTCGCACACCTGGTGGTCTCAGAGAGCGACA
GGAAAGCCCCCCTCGGGCCGAGGATCATTCTGCACCTCGGTCACGACGGCCCCGGACAACGGAGCCTTCCACATC
ACCACCTACGGAGGCTGGAGCCGGACCAACAACCGGGCCTACGAAGATGTGCACGTGCTCAGCATCCCGTCCTTT
ACCTGGATCGATGCCACCGCCCTTTCGGACCGGTCCAATGCCGAGCAGCAGGTCAACTCGACCATCGGACGGGAT
AGGCTCAGCGGGAGTTGTCAGACGCTCAACGGCCGGCAGATGGTCGTTGTTGGCGGTGAGATTCGTTCCGGCGCC
TTGCCTTTGACCGAGGCTTCGTGCGATGATGACTTTGAGCCGGTTCGGATCTTGGATCTGTCGACGTATGAGTGG
CAGTGGGAGCTACAAGATGGCAGGGATAGTTACCGGGTTCCGTCGGTGATATATGAGAGGATAGGAGGAGGTGCT
TCCGGGGGTGCCACAGTCACCGCTCCGCAAAGGGGCTTCGCCGACGCAACGCTATCATCTCTGCTGCAACTGCGC
GTCTCTACCGCAGTAGGCAACTCGCCATCATCGCACCGTTCCACCGGCTGGGGCTCCGAAGACTCCGGGAAGGGC
ATCGGAGCCGGGGCCGTGGCCGGGGCCGTGTTGGGCGCCATCGGCGGGCTGGTTGCCTTGGCCGGCTTTACTTGG
TTTCTACTGAGGAAGAGGCAGGAGAGGAGGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGGAGAAG
AAAATGAGGGAAGATGGGGAAGAAGAGGCTGGCATCAGGCAGGAGGACCGCGAGCCGCAGGAAATGGAGTCCATC
GACCTGACCAGCCCCGGGAGTCTGGTCAGTCCGCATAGCATGGCGAGTCCCAAGCCATCGGAGGCTGACGGACGG
GAGGTGTACGAGTTGCCCATCTGA
Transcript >Ophcf2|01550
ATGAAGCCCACCCTCCTCTTGCTCGCTTCCTTCGTGCCCTCGGCTCTCGCCCTCGTCAGTCACACATGGTCCTTC
AACAACGCACCGGCCGAAGGCTTCGATGACATCACCTTCCCCATGAACATCGCCGAGGCACCACACAAGGTCGGC
TTCTACTTTGCTGAGCAGTTCGACTTTTACAAGGTCCGCAAGCCGGCATACATCGGGCTGCAGCCCCAAGCCGAC
GGCGCCAACGGCCAGCCCATGATCCGCGCCGTCTTTTCCACTTTCCAGGGAGAGTCCAAGACGGCGGATAAGAAC
TGCAAACTCGGCGCCGATGACGGTCCTGGAGTCAGCTGCGCCGTCACGGTCCCTGCCAGCTACAAGGACACATAT
CATCTCAAGGTCCAGCATGTTTCGGGGACTACATGGAGAGGTTTGCTCATCAACAACTCGACGGGCGGCAACGAG
ATCCGGATCGGGCAGTGGACGCTCCCCAACGGAGCAGGGAAGGTGAAAAAGTTTCAGGCCGGCTTCGTCGAATAC
TTCCCGTGGAACTCGCCTCGTCGGCATCTATGCTCCGATCTGCCCAAGACAAAGGTCACTTTCGGCTTCCCGTTC
ACCAGCAGCATCGAGGAGCAGGGCATTATCGCCAAGCCTACCGAAGACGGGGACTCCTCATCTCTCTACTCACTC
TCCCTCACCACCGACTTCCCCGTCGAACGTCCAATCCCCCAATCCCTCCTCGAAAACACCACCATCAAGCACCGC
TCAACCCTCGCCCACGCAAGCGCCTCCCTCCCAGACGGCCTCGTGCTCTGGAACACACCCGACACCATCTACGCC
TTCGGCAGCGGCGGCCGCGGGAGAAGCGATCAGATAGCAGCCTACGACGTCAACAGCCGCAACTGGAGGGACGTC
AAGGTCAAGGGCGGAGACTTTAACTCTGGGCGCCGCACCGGCGCGCAGTATGTCAGTGTTCCGGGCTCGGATCTT
CACTTTGTTTATGGAGGGACGGCGCCTTATGGGGGGGGGATGCTGCGGTTCGACTCCAAGAAGTTATCGTGGACC
AACGAGACGCTCGGGCGTGGCTCGTTTGGGGTGCCGGTTCCGGGGCTTGACAATGGTGTCTTGGTCTATGTTCCC
GCTGGAAGGGAGGGGATGCTCATCAGCTTTGGCGGTGCCAACGTGACGGCAGGTATAAAGCCTGGCTGGGGCCGG
TCTTACGACTCCGACTGGCACATCATCTACGTCTACGACATCGCCTCGCACACCTGGTGGTCTCAGAGAGCGACA
GGAAAGCCCCCCTCGGGCCGAGGATCATTCTGCACCTCGGTCACGACGGCCCCGGACAACGGAGCCTTCCACATC
ACCACCTACGGAGGCTGGAGCCGGACCAACAACCGGGCCTACGAAGATGTGCACGTGCTCAGCATCCCGTCCTTT
ACCTGGATCGATGCCACCGCCCTTTCGGACCGGTCCAATGCCGAGCAGCAGGTCAACTCGACCATCGGACGGGAT
AGGCTCAGCGGGAGTTGTCAGACGCTCAACGGCCGGCAGATGGTCGTTGTTGGCGGTGAGATTCGTTCCGGCGCC
TTGCCTTTGACCGAGGCTTCGTGCGATGATGACTTTGAGCCGGTTCGGATCTTGGATCTGTCGACGTATGAGTGG
CAGTGGGAGCTACAAGATGGCAGGGATAGTTACCGGGTTCCGTCGGTGATATATGAGAGGATAGGAGGAGGTGCT
TCCGGGGGTGCCACAGTCACCGCTCCGCAAAGGGGCTTCGCCGACGCAACGCTATCATCTCTGCTGCAACTGCGC
GTCTCTACCGCAGTAGGCAACTCGCCATCATCGCACCGTTCCACCGGCTGGGGCTCCGAAGACTCCGGGAAGGGC
ATCGGAGCCGGGGCCGTGGCCGGGGCCGTGTTGGGCGCCATCGGCGGGCTGGTTGCCTTGGCCGGCTTTACTTGG
TTTCTACTGAGGAAGAGGCAGGAGAGGAGGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGGAGAAG
AAAATGAGGGAAGATGGGGAAGAAGAGGCTGGCATCAGGCAGGAGGACCGCGAGCCGCAGGAAATGGAGTCCATC
GACCTGACCAGCCCCGGGAGTCTGGTCAGTCCGCATAGCATGGCGAGTCCCAAGCCATCGGAGGCTGACGGACGG
GAGGTGTACGAGTTGCCCATCTGA
Gene >Ophcf2|01550
ATGAAGCCCACCCTCCTCTTGCTCGCTTCCTTCGTGCCCTCGGCTCTCGCCCTCGTCAGTCACACATGGTCCTTC
AACAACGCACCGGCCGAAGGCTTCGATGACATCACCTTCCCCATGAACATCGCCGAGGCACCACACAAGGTCGGC
TTCTACTTTGCTGAGCAGTTCGACTTTTACAAGGTCCGCAAGCCGGCATACATCGGGCTGCAGCCCCAAGCCGAC
GGCGCCAACGGCCAGCCCATGATCCGCGCCGTCTTTTCCACTTTCCAGGGAGAGTCCAAGACGGCGGATAAGAAC
TGCAAACTCGGCGCCGATGACGGTCCTGGAGTCAGCTGCGCCGTCACGGTCCCTGCCAGCTACAAGGACACATAT
CATCTCAAGGTCCAGCATGTTTCGGGGACTACATGGAGAGGTTTGCTCATCAACAACTCGACGGGCGGCAACGAG
ATCCGGATCGGGCAGTGGACGCTCCCCAACGGAGCAGGGAAGGTGAAAAAGTTTCAGGCCGGCTTCGTCGAATAC
TTCCCGTGGAACTCGCCTCGTCGGCATCTATGCTCCGATCTGCCCAAGACAAAGGTCACTTTCGGCTTCCCGTTC
ACCAGCAGCATCGAGGAGCAGGGCATTATCGCCAAGCCTACCGAAGACGGGGACTGTAGGGGCAAAGTTGCCGCT
GGCATCACGGCTGCACCGAACGGGTGGACGGTCAAAGTAGGGTGGCAATAAGTTGTGCATGGTTTCAGCCACGAG
GAGGGTCTTGCATGGGGAGTTTTGTACGTCTCTCATTGTCATGCAGGGCGCTGATGGTAACCGGATCCATCAAGG
GCGCAGATTAAGGCTGACATGACCGAGGTGAGAAAAGAAAAGGGGGCTGAGGCAATCCTTGTTGCTAAACTGAAG
AACAACAACAAGCTTCAATCAAGAAGCCATGATTCCAACTAGTTGAGCATATGTAGAAACCAAGAGAAAAAGAAA
CAGCCGCTCTATTCGCAGTCCTCAGAAGAGCTTAGCACAACCACATCAAAGAACAAAGTCCCATGCCCAAACTCC
AATCCAACCTATGACAGCTTCCCATCCCAACAAGGGCCCGTGTTATGACGAGAACGCGCATCAGACCATGGCAGC
CAATAAGCCCACCTTGCAAGCGCTAGTTCTCAGCTTCCGTTAAAAAGCAAGGCTGACACGCCTCCCGAGACCCGG
ACAAACCCTCGCCTCCCCCCCCCCCCCCCTTTGAAGCTGTTCCTCTCGCTTCAATCAACTTTCCTTTCTCGTCAG
ATGCCCTCTCGCGATCTTGCCTTGGCGTTCGCCGCTCATGGCGGGACGGGGTCTTTATGCGCTGGCCGCCTTGAG
CCTTTGGGGGTTGGCTTGCGGGACGCTGGGGGATATCTGCTATATTGTTGCTGCGAAGAGTAGGTTCGTTCTTAC
GTGAGACTTTGTTCTTGAGCTTACGATGCTGGGGGTTTGAAGCTGCTCTTTTGAACAACAACAGGCTGTACTTTA
TGGGCGGCAAGTATAGCATCGTCTCGCTTGGAGGATATTCGAGTTCGGCGAGTACGGGTCTCATTTCTGCGAAGA
TTGAGAAGAAGTAGAGCACTAATTGAAACAATCAAACCAGCCTCATCTCTCTACTCACTCTCCCTCACCACCGAC
TTCCCCGTCGAACGTCCAATCCCCCAATCCCTCCTCGAAAACACCACCATCAAGCACCGCTCAACCCTCGCCCAC
GCAAGCGCCTCCCTCCCAGACGGCCTCGTGCTCTGGAACACACCCGACACCATCTACGCCTTCGGCAGCGGCGGC
CGCGGGAGAAGCGATCAGATAGCAGCCTACGACGTCAACAGCCGCAACTGGAGGGACGTCAAGGTCAAGGGCGGA
GACTTTAACTCTGGGCGCCGCACCGGCGCGCAGTATGTCAGTGTTCCGGGCTCGGATCTTCACTTTGTTTATGGA
GGGACGGCGCCTTATGGGGGGGGGATGCTGCGGTTCGACTCCAAGAAGTTATCGTGGACCAACGAGACGCTCGGG
CGTGGCTCGTTTGGGGTGCCGGTTCCGGGGCTTGACAATGGTGTCTTGGTCTATGTTCCCGCTGGAAGGGAGGGG
ATGCTCATCAGCTTTGGCGGTGCCAACGTACGTATCTTCCGCGGGAGAGAGAGAGCTGGTATACTCACACGATAT
CAACTTATATAAAGGTGACGGCAGGTATAAAGCCTGGCTGGGGCCGGTCTTACGACTCCGACTGGCACATCATCT
ACGTCTACGACATCGCCTCGCACACCTGGTGGTCTCAGAGAGCGACAGGAAAGCCCCCCTCGGGCCGAGGATCAT
TCTGCACCTCGGTCACGACGGCCCCGGACAACGGAGCCTTCCACATCACCACCTACGGAGGCTGGAGCCGGACCA
ACAACCGGGCCTACGAAGATGTGCACGTGCTCAGCATCCCGTCCTTTACCTGGATCGATGCCACCGCCCTTTCGG
ACCGGTCCAATGCCGAGCAGCAGGTCAACTCGACCATCGGACGGGATAGGCTCAGCGGGAGTTGTCAGACGCTCA
ACGGCCGGCAGATGGTCGTTGTTGGCGGTGAGATTCGTTCCGGCGCCTTGCCTTTGACCGAGGCTTCGTGCGATG
ATGACTTTGAGCCGGTTCGGATCTTGGATCTGTCGACGTATGAGTGGCAGTGGGAGCTACAAGATGGCAGGGATA
GTTACCGGGTTCCGTCGGTGATATATGAGAGGATAGGAGGAGGGTACGTTCGAGACGATGGGGAGAGCCAACACA
GGAGCTAAACAAGTCCGATAGTGCTTCCGGGGGTGCCACAGTCACCGCTCCGCAAAGGGGCTTCGCCGACGCAAC
GCTATCATCTCTGCTGCAACTGCGCGTCTCTACCGCAGTAGGCAACTCGCCATCATCGCACCGTTCCACCGGCTG
GGGCTCCGAAGACTCCGGGAAGGGCATCGGAGCCGGGGCCGTGGCCGGGGCCGTGTTGGGCGCCATCGGCGGGCT
GGTTGCCTTGGCCGGCTTTACTTGGTTTCTACTGAGGAAGAGGCAGGAGAGGAGGAAGAAGAAGAAGAAGAAGAA
GAAGAAGAAGAAGAAGAAGGAGAAGAAAATGAGGGAAGATGGGGAAGAAGAGGCTGGCATCAGGCAGGAGGACCG
CGAGCCGCAGGAAATGGAGTCCATCGACCTGACCAGCCCCGGGAGTCTGGTCAGTCCGCATAGCATGGCGAGTCC
CAAGCCATCGGAGGCTGACGGACGGGAGGTGTACGAGTTGCCCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail