Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01546
Gene name
Locationscaffold_01:5289923..5291844
Strand+
Gene length (bp)1921
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10056 DUF2293 Uncharacterized conserved protein (DUF2293) 6.6E-30 173 261

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3498 0.9193 0.0639 0.0272 0.0816 0.0191 0.0439 0.0117 0.0104 0.0078

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup922
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4515
Ophiocordyceps australis map64 (Brazil) OphauB2|2427
Ophiocordyceps camponoti-floridani Ophcf2|01546 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2864
Ophiocordyceps kimflemingae Ophio5|1478
Ophiocordyceps subramaniannii Hirsu2|6381

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01546
MGKQKRRQPGGGGAKQRHKRAQPQRQPSVEEPPVRRDVVVKRPLPAVKSKHRSYFELVENKDKKKKLECQSTCTT
IPPPGFEYVPMGNPELTSLCKELSRERGLLIYVVSSTTQRFSLAAHMTRCGYHFEIAIVKEARRNIIHDPDLESS
VPHGDPEPIPASQELYHAQVDAAMRDLFPRIPHTDRHIIIGRAFTRGSRFKGEKVVGLIENMSLSRRVQLAVLAH
IRHNYTTYDELLKDIPWSEARRVIQPACLDVIVKWRGDEENGRDELDEILREVVIISDSEDDESDVDSSDGSSVV
EIGSSNVASSAYPRPSRTAHRPTQSGVDSDSRGRRGFDRYRRAWEDAVRRNDDRQEADRPVREGAGNAPRPLQEV
RGKTPAPNGYVPRAIQACGRAISPFSEAYNEPVVEVECRVHEHVWRNSCSHEPWLRLDSAYQETVFRSVETDSGP
QYSAWGSTARPDVRPRQERDVHRQHHGEQYCLSVTASSSSSRPMHGYAHAASFPVSSGHHHGDPSGWAPPVFSTS
SHHHPVRSMQASAPVAQPPAERIVMNTARPGSRWNPIVMEDRGGFYERIEESDSSPRQARR*
Coding >Ophcf2|01546
ATGGGTAAGCAGAAGCGTCGGCAGCCAGGCGGCGGTGGCGCCAAGCAGCGTCACAAGAGAGCTCAGCCTCAGCGG
CAACCTTCCGTCGAGGAACCCCCTGTGCGCAGAGACGTCGTTGTCAAGCGGCCGCTGCCCGCCGTCAAGTCCAAG
CACCGTAGCTATTTCGAGTTGGTTGAAAACAAGGACAAGAAGAAGAAACTCGAATGCCAGAGCACGTGCACGACG
ATCCCGCCTCCTGGATTCGAATATGTTCCCATGGGAAACCCGGAGTTGACCTCGTTATGCAAGGAGCTTTCTCGC
GAGAGGGGCTTGCTCATCTACGTCGTTTCGTCCACCACGCAGAGGTTCAGCCTCGCCGCTCACATGACCAGGTGC
GGCTACCATTTCGAAATCGCCATCGTAAAAGAGGCAAGGCGCAACATCATTCATGACCCGGATCTGGAGTCGTCG
GTTCCGCATGGAGATCCAGAGCCCATTCCAGCCTCTCAGGAGCTGTACCATGCTCAGGTCGATGCCGCCATGCGC
GATCTTTTCCCGCGCATACCTCACACAGATCGGCATATCATCATCGGCCGCGCCTTTACACGGGGCTCCCGATTC
AAGGGGGAGAAAGTCGTTGGGCTCATTGAAAACATGTCACTCTCTCGCAGGGTCCAGCTGGCGGTCCTGGCTCAC
ATCAGACACAATTACACCACGTACGACGAACTGCTCAAGGACATTCCGTGGTCCGAAGCCCGGAGGGTCATTCAG
CCTGCCTGTCTCGACGTCATTGTCAAGTGGCGTGGGGACGAAGAGAACGGCCGGGACGAGCTCGATGAGATATTA
CGTGAAGTTGTCATCATCTCCGACTCGGAGGATGATGAGTCCGATGTGGACTCCTCAGACGGCTCGTCTGTTGTG
GAGATTGGCTCGTCCAATGTGGCGTCGTCGGCGTACCCACGGCCATCCCGTACGGCTCACCGACCGACGCAATCC
GGCGTCGACTCAGACAGCAGAGGTCGCCGTGGTTTTGACCGTTACCGCCGTGCCTGGGAAGACGCCGTGCGGCGG
AACGATGACCGTCAGGAGGCTGACAGACCCGTTCGTGAAGGTGCTGGAAACGCACCACGACCTCTCCAGGAAGTC
CGCGGTAAAACCCCCGCGCCCAACGGCTATGTGCCACGTGCCATACAAGCGTGTGGACGGGCGATAAGCCCCTTT
TCCGAGGCTTACAATGAGCCCGTCGTCGAGGTAGAGTGTCGCGTACATGAGCACGTTTGGAGGAACAGCTGCTCA
CATGAACCATGGCTGCGACTGGACTCTGCATATCAGGAGACGGTGTTTCGTTCCGTCGAGACGGACTCCGGGCCG
CAGTACTCTGCTTGGGGCTCTACGGCACGCCCTGACGTGAGACCGAGACAGGAACGTGACGTGCATCGCCAGCAT
CATGGCGAGCAGTACTGTCTGTCTGTTACGGCGTCCAGCAGCAGCTCGCGGCCCATGCACGGCTACGCACATGCC
GCTTCGTTCCCAGTGTCGTCGGGCCATCATCATGGTGATCCCAGCGGATGGGCGCCGCCCGTCTTCTCCACGTCC
AGCCACCACCACCCGGTTCGAAGCATGCAAGCTTCTGCTCCCGTCGCTCAGCCGCCGGCCGAACGCATCGTCATG
AACACGGCTCGGCCCGGCTCTCGCTGGAACCCCATCGTTATGGAGGATCGCGGCGGTTTCTACGAGAGGATCGAG
GAGTCCGACTCTTCGCCACGCCAGGCCAGACGCTGA
Transcript >Ophcf2|01546
ATGGGTAAGCAGAAGCGTCGGCAGCCAGGCGGCGGTGGCGCCAAGCAGCGTCACAAGAGAGCTCAGCCTCAGCGG
CAACCTTCCGTCGAGGAACCCCCTGTGCGCAGAGACGTCGTTGTCAAGCGGCCGCTGCCCGCCGTCAAGTCCAAG
CACCGTAGCTATTTCGAGTTGGTTGAAAACAAGGACAAGAAGAAGAAACTCGAATGCCAGAGCACGTGCACGACG
ATCCCGCCTCCTGGATTCGAATATGTTCCCATGGGAAACCCGGAGTTGACCTCGTTATGCAAGGAGCTTTCTCGC
GAGAGGGGCTTGCTCATCTACGTCGTTTCGTCCACCACGCAGAGGTTCAGCCTCGCCGCTCACATGACCAGGTGC
GGCTACCATTTCGAAATCGCCATCGTAAAAGAGGCAAGGCGCAACATCATTCATGACCCGGATCTGGAGTCGTCG
GTTCCGCATGGAGATCCAGAGCCCATTCCAGCCTCTCAGGAGCTGTACCATGCTCAGGTCGATGCCGCCATGCGC
GATCTTTTCCCGCGCATACCTCACACAGATCGGCATATCATCATCGGCCGCGCCTTTACACGGGGCTCCCGATTC
AAGGGGGAGAAAGTCGTTGGGCTCATTGAAAACATGTCACTCTCTCGCAGGGTCCAGCTGGCGGTCCTGGCTCAC
ATCAGACACAATTACACCACGTACGACGAACTGCTCAAGGACATTCCGTGGTCCGAAGCCCGGAGGGTCATTCAG
CCTGCCTGTCTCGACGTCATTGTCAAGTGGCGTGGGGACGAAGAGAACGGCCGGGACGAGCTCGATGAGATATTA
CGTGAAGTTGTCATCATCTCCGACTCGGAGGATGATGAGTCCGATGTGGACTCCTCAGACGGCTCGTCTGTTGTG
GAGATTGGCTCGTCCAATGTGGCGTCGTCGGCGTACCCACGGCCATCCCGTACGGCTCACCGACCGACGCAATCC
GGCGTCGACTCAGACAGCAGAGGTCGCCGTGGTTTTGACCGTTACCGCCGTGCCTGGGAAGACGCCGTGCGGCGG
AACGATGACCGTCAGGAGGCTGACAGACCCGTTCGTGAAGGTGCTGGAAACGCACCACGACCTCTCCAGGAAGTC
CGCGGTAAAACCCCCGCGCCCAACGGCTATGTGCCACGTGCCATACAAGCGTGTGGACGGGCGATAAGCCCCTTT
TCCGAGGCTTACAATGAGCCCGTCGTCGAGGTAGAGTGTCGCGTACATGAGCACGTTTGGAGGAACAGCTGCTCA
CATGAACCATGGCTGCGACTGGACTCTGCATATCAGGAGACGGTGTTTCGTTCCGTCGAGACGGACTCCGGGCCG
CAGTACTCTGCTTGGGGCTCTACGGCACGCCCTGACGTGAGACCGAGACAGGAACGTGACGTGCATCGCCAGCAT
CATGGCGAGCAGTACTGTCTGTCTGTTACGGCGTCCAGCAGCAGCTCGCGGCCCATGCACGGCTACGCACATGCC
GCTTCGTTCCCAGTGTCGTCGGGCCATCATCATGGTGATCCCAGCGGATGGGCGCCGCCCGTCTTCTCCACGTCC
AGCCACCACCACCCGGTTCGAAGCATGCAAGCTTCTGCTCCCGTCGCTCAGCCGCCGGCCGAACGCATCGTCATG
AACACGGCTCGGCCCGGCTCTCGCTGGAACCCCATCGTTATGGAGGATCGCGGCGGTTTCTACGAGAGGATCGAG
GAGTCCGACTCTTCGCCACGCCAGGCCAGACGCTGA
Gene >Ophcf2|01546
ATGGGTAAGCAGAAGCGTCGGCAGCCAGGCGGCGGTGGCGCCAAGCAGCGTCACAAGAGAGCTCAGCCTCAGCGG
CAACCTTCCGTCGAGGAACCCCCTGTGCGCAGAGACGTCGTTGTCAAGCGGCCGCTGCCCGCCGTCAAGTCCAAG
CACCGTAGCTATTTCGAGTTGGTTGAAAACAAGGACAAGAAGAAGAAACTCGAATGCCAGGTAAGCTCGCATTTC
CAACCCCCTTGCCATTCCTGCTAACTTGCTGTAGAGCACGTGCACGACGATCCCGCCTCCTGGATTCGAATATGT
TCCCATGGGAAACCCGGAGTTGACCTCGTTATGCAAGGAGCTTTCTCGCGAGAGGGGCTTGCTCATCTACGTCGT
TTCGGTGCGGAACGACAAGACTGATCGCCGCCTTACTCGACTTACTCACTCTGAGCAGTCCACCACGCAGAGGTT
CAGCCTCGCCGCTCACATGACCAGGTGCGGCTACCATTTCGAAATCGCCATCGTAAAAGAGGCAAGGCGCAACAT
CATTCATGACCCGGATCTGGAGTCGTCGGTTCCGCATGGAGATCCAGAGCCCATTCCAGCCTCTCAGGAGCTGTA
CCATGCTCAGGTCGATGCCGCCATGCGCGATCTTTTCCCGCGCATACCTCACACAGATCGGCATATCATCATCGG
CCGCGCCTTTACACGGGTATGTAAATCGTACCCAGACCCATTAGACTCACCTCGTGCTGACCGTTTTGTCCAGGG
CTCCCGATTCAAGGGGGAGAAAGTCGTTGGGCTCATTGAAAACATGTCACTCTCTCGCAGGGTCCAGCTGGCGGT
CCTGGCTCACATCAGACACAATTACACCACGTACGACGAACTGCTCAAGGACATTCCGTGGTCCGAAGCCCGGAG
GGTCATTCAGCCTGCCTGTCTCGACGTCATTGTCAAGTGGCGTGGGGACGAAGAGAACGGCCGGGACGAGCTCGA
TGAGATATTACGTGAAGTTGTCATCATCTCCGACTCGGAGGATGATGAGTCCGATGTGGACTCCTCAGACGGCTC
GTCTGTTGTGGAGATTGGCTCGTCCAATGTGGCGTCGTCGGCGTACCCACGGCCATCCCGTACGGCTCACCGACC
GACGCAATCCGGCGTCGACTCAGACAGCAGAGGTCGCCGTGGTTTTGACCGTTACCGCCGTGCCTGGGAAGACGC
CGTGCGGCGGAACGATGACCGTCAGGAGGCTGACAGACCCGTTCGTGAAGGTGCTGGAAACGCACCACGACCTCT
CCAGGAAGTCCGCGGTAAAACCCCCGCGCCCAACGGCTATGTGCCACGTGCCATACAAGCGTGTGGACGGGCGAT
AAGCCCCTTTTCCGAGGCTTACAATGAGCCCGTCGTCGAGGTAGAGTGTCGCGTACATGAGCACGTTTGGAGGAA
CAGCTGCTCACATGAACCATGGCTGCGACTGGACTCTGCATATCAGGAGACGGTGTTTCGTTCCGTCGAGACGGA
CTCCGGGCCGCAGTACTCTGCTTGGGGCTCTACGGCACGCCCTGACGTGAGACCGAGACAGGAACGTGACGTGCA
TCGCCAGCATCATGGCGAGCAGTACTGTCTGTCTGTTACGGCGTCCAGCAGCAGCTCGCGGCCCATGCACGGCTA
CGCACATGCCGCTTCGTTCCCAGTGTCGTCGGGCCATCATCATGGTGATCCCAGCGGATGGGCGCCGCCCGTCTT
CTCCACGTCCAGCCACCACCACCCGGTTCGAAGCATGCAAGCTTCTGCTCCCGTCGCTCAGCCGCCGGCCGAACG
CATCGTCATGAACACGGCTCGGCCCGGCTCTCGCTGGAACCCCATCGTTATGGAGGATCGCGGCGGTTTCTACGA
GAGGATCGAGGAGTCCGACTCTTCGCCACGCCAGGCCAGACGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail