Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01543
Gene name
Locationscaffold_01:5280811..5282861
Strand+
Gene length (bp)2050
Transcript length (bp)1929
Coding sequence length (bp)1929
Protein length (aa) 643

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07576 BRAP2 BRCA1-associated protein 2 3.8E-27 199 292
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 7.9E-18 399 457
PF13639 zf-RING_2 Ring finger domain 1.2E-08 329 369
PF17123 zf-RING_11 RING-like zinc finger 7.9E-07 330 357
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 6.9E-06 330 368

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.7216 0.5759 0.0396 0.026 0.0789 0.0162 0.1479 0.423 0.2895 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4971
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4934
Ophiocordyceps australis map64 (Brazil) OphauB2|949
Ophiocordyceps camponoti-floridani Ophcf2|01543 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6557
Ophiocordyceps kimflemingae Ophio5|4878
Ophiocordyceps subramaniannii Hirsu2|2106

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01543
MVTPRYYYHLHFDLYSTPNPESEGPSPERAGGIWLPPPGASAFDRLPSHPTHGRAIRDDRRHRGGEAREEKVSGS
ESSLTVDESRILQPSVIDCGSSRSDEEPRRRLRTLSSPTAATQTVRDWRFGRVSIDTADPITMSPTEAGKAAPPL
GPSFGGASATKAEWLPLDTKHTELGWGVIRFYRDGDEVPTSAGDEESGDEDCCVLCIPAVPAYMSPGDFMGFVGD
RWMGDISHCRMVMTSSMNRYLVLLRFREAERARLWKREFDGKVFNSIESRVCHVVMVKSITFSRNHHSEATAPSS
SSSSSSAAVVSSSLKPFPPPTPNLIELPTCPVCLERMDETNGLMTIPCSHVFHCTCLQNWRGAGCPVCRFTNASP
QAGAGDDGDDPNSRSFGAPVSNLCSVCDCADDLWICLICGHVGCGRYKGGHAKDHWKDTAHCFALELETQHVWDY
AGDVWVHRLIRDKGDGKVVELPGRGSPHDGQRQQQQQQQQQQQQQQQQQQQHQGQDVVPRAKLDNIGLEYTHLIT
SQLESQRAYYEDMISKVADKAAASAASAEASAARTTDLTARLSLVEERHEALQTTTLPQLERDVERQRCKAERAE
KLARDLGRSLQEEKRVNEGLMQRIAHLDEGLAVAKAEVEKRG*
Coding >Ophcf2|01543
ATGGTAACTCCTCGTTACTACTATCACCTCCACTTCGACCTCTATTCTACTCCGAATCCCGAGAGCGAGGGGCCG
TCGCCAGAGCGGGCCGGCGGCATCTGGCTGCCGCCGCCGGGAGCCAGCGCCTTTGATCGTCTGCCGTCACATCCG
ACGCACGGGCGGGCGATCCGCGACGACAGGAGGCACAGGGGAGGAGAGGCCCGGGAGGAGAAGGTATCCGGGAGC
GAGAGCAGCTTGACGGTCGACGAGAGCCGTATCCTACAACCGAGCGTCATCGACTGCGGAAGCAGCCGCAGCGAC
GAGGAACCACGCAGACGGCTCAGGACGCTTTCGAGCCCAACAGCTGCGACACAAACGGTTCGAGACTGGCGCTTC
GGACGGGTGAGCATCGACACGGCCGATCCCATCACCATGTCCCCTACCGAGGCGGGCAAGGCGGCGCCTCCGCTC
GGCCCATCCTTTGGCGGTGCCTCTGCCACCAAGGCCGAATGGCTACCGCTGGACACGAAACATACCGAGTTGGGA
TGGGGCGTCATCCGCTTCTACCGCGATGGCGACGAGGTGCCTACTTCGGCTGGGGACGAAGAATCGGGCGATGAG
GACTGCTGCGTGCTCTGCATCCCCGCTGTGCCGGCGTACATGTCGCCGGGGGACTTTATGGGCTTCGTTGGGGAT
CGGTGGATGGGCGATATCAGTCACTGTCGAATGGTTATGACTTCGAGCATGAATCGGTATTTGGTACTGTTGAGG
TTTCGCGAGGCTGAGAGGGCGAGGCTCTGGAAGCGTGAGTTTGATGGCAAGGTCTTTAACTCGATCGAGTCTCGA
GTCTGCCACGTCGTCATGGTCAAGTCGATTACATTCTCACGCAACCATCATTCCGAGGCGACGGCACCATCGTCG
TCGTCGTCGTCTTCGTCAGCCGCCGTCGTTTCCAGCAGCCTTAAGCCCTTCCCACCGCCGACGCCCAACCTCATC
GAGCTGCCTACCTGCCCCGTCTGCCTGGAGAGAATGGACGAAACCAACGGGCTGATGACGATACCGTGTTCGCAC
GTCTTTCACTGCACCTGTCTTCAGAACTGGCGCGGAGCCGGCTGTCCCGTCTGCCGCTTTACAAACGCCTCTCCT
CAGGCGGGCGCCGGCGATGACGGCGATGATCCCAACTCGCGATCGTTTGGAGCGCCGGTTTCGAATCTCTGCAGC
GTTTGCGACTGTGCTGATGATCTTTGGATCTGTCTTATCTGCGGACACGTTGGTTGTGGACGGTACAAGGGTGGG
CATGCCAAGGATCATTGGAAGGATACGGCTCATTGCTTTGCGCTTGAGCTCGAGACGCAGCATGTTTGGGATTAT
GCTGGTGATGTCTGGGTGCATCGGCTGATTCGTGACAAGGGAGATGGTAAGGTGGTTGAGCTGCCGGGGAGAGGG
AGTCCCCATGACGGACAACGACAACAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAACAACAACAACAACAA
CAACACCAAGGTCAAGATGTGGTGCCGCGGGCCAAGCTGGACAACATTGGGCTCGAGTACACGCATCTGATTACC
AGTCAGCTGGAGTCACAGCGAGCCTACTACGAAGACATGATCAGCAAGGTAGCCGACAAGGCCGCCGCCTCAGCA
GCTTCAGCCGAAGCCAGCGCGGCGCGAACAACCGATCTAACCGCCCGTCTCTCCCTCGTCGAAGAGCGTCACGAA
GCCCTCCAAACAACAACGCTCCCCCAACTCGAGCGCGACGTCGAGAGACAGCGCTGCAAAGCGGAGCGGGCGGAG
AAGCTGGCGCGGGATCTCGGCCGTTCGCTACAGGAGGAGAAGAGGGTGAATGAGGGGCTGATGCAGCGGATCGCC
CATCTTGATGAAGGGCTTGCGGTTGCCAAGGCCGAGGTTGAGAAGAGAGGTTGA
Transcript >Ophcf2|01543
ATGGTAACTCCTCGTTACTACTATCACCTCCACTTCGACCTCTATTCTACTCCGAATCCCGAGAGCGAGGGGCCG
TCGCCAGAGCGGGCCGGCGGCATCTGGCTGCCGCCGCCGGGAGCCAGCGCCTTTGATCGTCTGCCGTCACATCCG
ACGCACGGGCGGGCGATCCGCGACGACAGGAGGCACAGGGGAGGAGAGGCCCGGGAGGAGAAGGTATCCGGGAGC
GAGAGCAGCTTGACGGTCGACGAGAGCCGTATCCTACAACCGAGCGTCATCGACTGCGGAAGCAGCCGCAGCGAC
GAGGAACCACGCAGACGGCTCAGGACGCTTTCGAGCCCAACAGCTGCGACACAAACGGTTCGAGACTGGCGCTTC
GGACGGGTGAGCATCGACACGGCCGATCCCATCACCATGTCCCCTACCGAGGCGGGCAAGGCGGCGCCTCCGCTC
GGCCCATCCTTTGGCGGTGCCTCTGCCACCAAGGCCGAATGGCTACCGCTGGACACGAAACATACCGAGTTGGGA
TGGGGCGTCATCCGCTTCTACCGCGATGGCGACGAGGTGCCTACTTCGGCTGGGGACGAAGAATCGGGCGATGAG
GACTGCTGCGTGCTCTGCATCCCCGCTGTGCCGGCGTACATGTCGCCGGGGGACTTTATGGGCTTCGTTGGGGAT
CGGTGGATGGGCGATATCAGTCACTGTCGAATGGTTATGACTTCGAGCATGAATCGGTATTTGGTACTGTTGAGG
TTTCGCGAGGCTGAGAGGGCGAGGCTCTGGAAGCGTGAGTTTGATGGCAAGGTCTTTAACTCGATCGAGTCTCGA
GTCTGCCACGTCGTCATGGTCAAGTCGATTACATTCTCACGCAACCATCATTCCGAGGCGACGGCACCATCGTCG
TCGTCGTCGTCTTCGTCAGCCGCCGTCGTTTCCAGCAGCCTTAAGCCCTTCCCACCGCCGACGCCCAACCTCATC
GAGCTGCCTACCTGCCCCGTCTGCCTGGAGAGAATGGACGAAACCAACGGGCTGATGACGATACCGTGTTCGCAC
GTCTTTCACTGCACCTGTCTTCAGAACTGGCGCGGAGCCGGCTGTCCCGTCTGCCGCTTTACAAACGCCTCTCCT
CAGGCGGGCGCCGGCGATGACGGCGATGATCCCAACTCGCGATCGTTTGGAGCGCCGGTTTCGAATCTCTGCAGC
GTTTGCGACTGTGCTGATGATCTTTGGATCTGTCTTATCTGCGGACACGTTGGTTGTGGACGGTACAAGGGTGGG
CATGCCAAGGATCATTGGAAGGATACGGCTCATTGCTTTGCGCTTGAGCTCGAGACGCAGCATGTTTGGGATTAT
GCTGGTGATGTCTGGGTGCATCGGCTGATTCGTGACAAGGGAGATGGTAAGGTGGTTGAGCTGCCGGGGAGAGGG
AGTCCCCATGACGGACAACGACAACAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAACAACAACAACAACAA
CAACACCAAGGTCAAGATGTGGTGCCGCGGGCCAAGCTGGACAACATTGGGCTCGAGTACACGCATCTGATTACC
AGTCAGCTGGAGTCACAGCGAGCCTACTACGAAGACATGATCAGCAAGGTAGCCGACAAGGCCGCCGCCTCAGCA
GCTTCAGCCGAAGCCAGCGCGGCGCGAACAACCGATCTAACCGCCCGTCTCTCCCTCGTCGAAGAGCGTCACGAA
GCCCTCCAAACAACAACGCTCCCCCAACTCGAGCGCGACGTCGAGAGACAGCGCTGCAAAGCGGAGCGGGCGGAG
AAGCTGGCGCGGGATCTCGGCCGTTCGCTACAGGAGGAGAAGAGGGTGAATGAGGGGCTGATGCAGCGGATCGCC
CATCTTGATGAAGGGCTTGCGGTTGCCAAGGCCGAGGTTGAGAAGAGAGGTTGA
Gene >Ophcf2|01543
ATGGTAACTCCTCGTTACTACTATCACCTCCACTTCGACCTCTATTCTACTCCGAATCCCGAGAGCGAGGGGCCG
TCGCCAGAGCGGGCCGGCGGCATCTGGCTGCCGCCGCCGGGAGCCAGCGCCTTTGATCGTCTGCCGTCACATCCG
ACGCACGGGCGGGCGATCCGCGACGACAGGAGGCACAGGGGAGGAGAGGCCCGGGAGGAGAAGGTATCCGGGAGC
GAGAGCAGCTTGACGGTCGACGAGAGCCGTATCCTACAACCGAGCGTCATCGACTGCGGAAGCAGCCGCAGCGAC
GAGGAACCACGCAGACGGCTCAGGACGCTTTCGAGCCCAACAGCTGCGACACAAACGGTTCGAGACTGGCGCTTC
GGACGGGTGAGCATCGACACGGCCGATCCCATCACCATGTCCCCTACCGAGGCGGGCAAGGCGGCGCCTCCGCTC
GGCCCATCCTTTGGCGGTGCCTCTGCCACCAAGGCCGAATGGCTACCGCTGGACACGAAACATACCGAGTTGGGA
TGGGGCGTCATCCGCTTCTACCGCGATGGCGACGAGGTGCCTACTTCGGCTGGGGACGAAGAATCGGGCGATGAG
GACTGCTGCGTGCTCTGCATCCCCGCTGTGCCGGCGTACATGTCGCCGGGGGACTTTATGGGCTTCGTTGGGGAT
CGGTGGATGGGCGATATCAGTCACTGTCGAATGGTTATGACTTCGAGCATGAATCGGTATTTGGTACTGTTGAGG
TTTCGCGAGGCTGAGAGGGCGAGGCTCTGGAAGCGTGAGTTTGATGGCAAGGTCTTTAACTCGATCGAGGTGAGT
TACGACTTGTTTCCATCACCCTTCACTCGGTTATGCTGATGGGCAAAGTCTCGAGTCTGCCACGTCGTCATGGTC
AAGTCGATTACATTCTCACGCAACCATCATTCCGAGGCGACGGCACCATCGTCGTCGTCGTCGTCTTCGTCAGCC
GCCGTCGTTTCCAGCAGCCTTAAGCCCTTCCCACCGCCGACGCCCAACCTCATCGAGCTGCCTACCTGCCCCGTC
TGCCTGGAGAGAATGGACGAAACCAACGGGCTGATGACGATACCGTGTTCGCACGTCTTTCACTGCACCTGTCTT
CAGAACTGGCGCGGAGCCGGCTGTCCCGTCTGCCGCTTTACAAACGCCTCTCCTCAGGCGGGCGCCGGCGATGAC
GGCGATGATCCCAACTCGCGATCGTTTGGAGCGCCGGTTTCGAATCTCTGCAGCGTTTGCGACTGTGCTGATGAT
CTTTGGATCTGTCTTATCTGCGGACACGTTGGTTGTGGACGGTACAAGGGTGGGCATGCCAAGGATCATTGGAAG
GATACGGCTCATTGCTTTGCGCTTGAGCTCGAGACGCAGCATGTTTGGGATTATGCTGGTGATGTCTGGGTGCAT
CGGCTGATTCGTGACAAGGGAGATGGTAAGGTGGTTGAGCTGCCGGGGAGAGGGAGTCCCCATGACGGACAACGA
CAACAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAACAACAACAACAACAACAACACCAAGGTCAAGATGTG
GTGCCGCGGGCCAAGCTGGACAACATTGGGCTCGAGTACACGCATCTGATTACCAGTCAGCTGGAGTCACAGCGA
GCCTACTACGAAGACATGATCAGCAAGGTAGCCGACAAGGCCGCCGCCTCAGCAGCTTCAGCCGAAGCCAGCGCG
GCGCGAACAACCGATCTAACCGCCCGTCTCTCCCTCGTCGAAGAGCGTCACGAAGCCCTCCAAACAACAACGCTC
CCCCAACTCGAGCGCGACGTCGAGAGACAGCGCTGCAAAGCGGAGCGGGCGGAGAAGCTGGCGCGGGATCTCGGC
CGTTCGCTACAGGAGGAGAAGAGGGTGAATGAGGGGCTGATGCAGCGGATCGCCCATCTTGATGAAGGGCTTGCG
GTTGCCAAGGCCGAGGTTGAGAAGTTGAGGGGGGAGAAGGGCGAGTTGGAGGAGTTGAATCGAGACTTGTCGGCT
TTTATATCGGGGCAGGAGAGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail