Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01525
Gene name
Locationscaffold_01:5225530..5226517
Strand+
Gene length (bp)987
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 5.6E-27 37 223

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5351 0.4768 0.0666 0.1483 0.4389 0.0234 0.1371 0.0862 0.3478 0.0585

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup387
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7550
Ophiocordyceps australis map64 (Brazil) OphauB2|5021
Ophiocordyceps australis map64 (Brazil) OphauB2|5327
Ophiocordyceps camponoti-floridani Ophcf2|01525 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|124
Ophiocordyceps kimflemingae Ophio5|7621
Ophiocordyceps subramaniannii Hirsu2|1512
Ophiocordyceps subramaniannii Hirsu2|7438

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01525
MASDFEYVKRMTPPGYVFPSARLQRTCEAGRTPLVLVACGSFSPITFLHLRMFPMARDHCRNEGFEVIGGYFSLV
SDAYKKKGLAPACHRLRMCELAAENTSNWLMVDPWEAEHTTYIPTARVLDHFEYEINHVMGGVECSDGTRKRAKI
VLLAGADLIQTISNPDVWDARDVDHILGDFGVFVLERTGTELDSALASLKQWEKNIHVIRQVVTNDISSTKVRLL
LKRDMSIDYLIPAEVIRYIDEHPSIYRDLDLPVDKSKDNDEAPTKMRASNG*
Coding >Ophcf2|01525
ATGGCATCCGACTTCGAATACGTCAAGCGAATGACGCCTCCGGGCTACGTCTTTCCCTCCGCTCGTCTACAGCGC
ACCTGCGAGGCCGGTCGAACGCCCCTCGTCCTCGTCGCCTGCGGATCCTTCTCGCCCATCACCTTTCTACACCTC
CGCATGTTCCCCATGGCTCGAGATCACTGTCGTAACGAAGGCTTCGAAGTCATTGGCGGCTACTTCTCCCTCGTG
TCCGATGCCTATAAGAAGAAGGGGCTCGCGCCCGCCTGTCACCGCCTGCGAATGTGCGAGCTGGCGGCCGAGAAC
ACGTCCAACTGGCTCATGGTCGACCCCTGGGAAGCCGAGCACACCACCTATATCCCTACTGCCCGAGTCCTCGAT
CACTTCGAGTACGAGATTAACCATGTCATGGGCGGCGTCGAGTGTTCCGATGGCACCCGCAAACGCGCCAAGATT
GTCCTCCTGGCCGGCGCCGACCTGATTCAGACGATTAGCAACCCAGACGTTTGGGATGCCCGTGACGTCGACCAC
ATCCTCGGCGACTTTGGCGTCTTTGTCCTCGAGCGTACCGGAACCGAGCTCGACTCTGCCCTGGCTAGCCTGAAG
CAATGGGAGAAGAACATACACGTCATCCGTCAGGTGGTGACGAATGACATCAGCAGCACAAAGGTGCGATTGTTG
CTAAAGCGAGATATGAGCATCGACTATCTCATACCAGCCGAAGTGATTCGCTACATCGACGAGCACCCATCCATC
TATCGCGATCTAGATCTACCCGTCGACAAGAGCAAAGACAATGACGAGGCGCCTACCAAGATGCGGGCCAGCAAC
GGCTGA
Transcript >Ophcf2|01525
ATGGCATCCGACTTCGAATACGTCAAGCGAATGACGCCTCCGGGCTACGTCTTTCCCTCCGCTCGTCTACAGCGC
ACCTGCGAGGCCGGTCGAACGCCCCTCGTCCTCGTCGCCTGCGGATCCTTCTCGCCCATCACCTTTCTACACCTC
CGCATGTTCCCCATGGCTCGAGATCACTGTCGTAACGAAGGCTTCGAAGTCATTGGCGGCTACTTCTCCCTCGTG
TCCGATGCCTATAAGAAGAAGGGGCTCGCGCCCGCCTGTCACCGCCTGCGAATGTGCGAGCTGGCGGCCGAGAAC
ACGTCCAACTGGCTCATGGTCGACCCCTGGGAAGCCGAGCACACCACCTATATCCCTACTGCCCGAGTCCTCGAT
CACTTCGAGTACGAGATTAACCATGTCATGGGCGGCGTCGAGTGTTCCGATGGCACCCGCAAACGCGCCAAGATT
GTCCTCCTGGCCGGCGCCGACCTGATTCAGACGATTAGCAACCCAGACGTTTGGGATGCCCGTGACGTCGACCAC
ATCCTCGGCGACTTTGGCGTCTTTGTCCTCGAGCGTACCGGAACCGAGCTCGACTCTGCCCTGGCTAGCCTGAAG
CAATGGGAGAAGAACATACACGTCATCCGTCAGGTGGTGACGAATGACATCAGCAGCACAAAGGTGCGATTGTTG
CTAAAGCGAGATATGAGCATCGACTATCTCATACCAGCCGAAGTGATTCGCTACATCGACGAGCACCCATCCATC
TATCGCGATCTAGATCTACCCGTCGACAAGAGCAAAGACAATGACGAGGCGCCTACCAAGATGCGGGCCAGCAAC
GGCTGA
Gene >Ophcf2|01525
ATGGCATCCGACTTCGAATACGTCAAGCGAATGACGCCTCCGGGCTACGTCTTTCCCTCCGCTCGTCTACAGCGC
ACCTGCGAGGCCGGTCGAACGCCCCTCGTCCTCGTCGCCTGCGGATCCTGTGAGTCGCAGCGGGCCCTCGGTGTT
ACCACCAGACTTGCGCTGACCATTGGCAGTCTCGCCCATCACCTTTCTACACCTCCGCATGTTCCCCATGGCTCG
AGATCACTGTCGTAACGAAGGCTTCGAAGTCATTGGCGGCTACTTCTCCCTCGTGTCCGATGCCTATAAGAAGAA
GGGGCTCGCGCCCGCCTGTCACCGCCTGCGAATGTGCGAGCTGGCGGCCGAGAACACGTCCAACTGGCTCATGGT
CGACCCCTGGGAAGCCGAGCACACCACCTATATCCCTACTGCCCGAGTCCTCGATCACTTCGAGTACGAGATTAA
CCATGTCATGGGCGGCGTCGAGTGTTCCGATGGCACCCGCAAACGCGCCAAGATTGTCCTCCTGGCCGGCGCCGA
CCTGATTCAGACGATTAGCAACCCAGACGTTTGGGATGCCCGTGACGTCGACCACATCCTCGGCGACTTTGGCGT
CTTTGTCCTCGAGCGTACCGGAACCGAGCTCGACTCTGCCCTGGCTAGCCTGAAGCAATGGGAGAAGAACATACA
CGTCATCCGTCAGGTAAGAGTGGTCGCAACTCGATGGAATGGAAGAAGCTCACTCTGGCTCAAGGTGGTGACGAA
TGACATCAGCAGCACAAAGGTGCGATTGTTGCTAAAGCGAGATATGAGCATCGACTATCTGTGAGTGGCCGACGT
CTTCCTCCGTCATCGGCAACTGACTCGCGGTGCAGCATACCAGCCGAAGTGATTCGCTACATCGACGAGCACCCA
TCCATCTATCGCGATCTAGATCTACCCGTCGACAAGAGCAAAGACAATGACGAGGCGCCTACCAAGATGCGGGCC
AGCAACGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail