Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01519
Gene name
Locationscaffold_01:5207247..5208509
Strand-
Gene length (bp)1262
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04078 Rcd1 Cell differentiation family, Rcd1-like 4.2E-124 85 342

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6161 0.8541 0.0098 0.0592 0.088 0.0025 0.1447 0.187 0.1271 0.0053

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1464
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|582
Ophiocordyceps australis map64 (Brazil) OphauB2|911
Ophiocordyceps camponoti-floridani Ophcf2|01519 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5241
Ophiocordyceps kimflemingae Ophio5|2769
Ophiocordyceps subramaniannii Hirsu2|11045

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01519
MIPSAHVYGHHPFQGGDSPWLHHQPGHHQPGHQSLGQQHQQHQQHQHFGAMAVNHSAAAGMAAAHAQDAAHENIS
EENRRTMAFIADLLNESTREAALLELSKKREQVPELALILWHSFGVMTSLLQEIISVYTLLNPSQLTAAASNRVC
NALALLQCVASHNDTRALFLSAHIPLFLYPFLNTTSKSRPFEYLRLTSLGVIGALVKNDSSDVINFLLTTEIIPL
CLRIMETGSELSKTVAIFIVQKILLDDNGLNYICATYERFYAVGTVLSNMVAQLVESQTARLLKHVVRCFLRLSD
NARAREALRQCLPEPLRDATFSSVLRDDAATKRCLAQLLINLSDNVVDPGAQPSM*
Coding >Ophcf2|01519
ATGATTCCATCGGCGCACGTCTACGGACACCATCCGTTCCAGGGCGGCGATTCACCCTGGCTTCACCACCAGCCT
GGCCATCACCAGCCTGGCCACCAGAGCCTCGGCCAGCAGCACCAGCAGCACCAGCAGCATCAGCACTTTGGCGCC
ATGGCTGTCAACCACTCTGCTGCTGCTGGCATGGCCGCCGCTCACGCTCAGGATGCGGCTCACGAGAATATTTCG
GAGGAGAACCGACGGACCATGGCCTTTATTGCCGACCTCCTCAACGAGAGTACCAGGGAGGCTGCCCTCTTGGAG
CTTAGCAAGAAACGCGAACAGGTCCCTGAGCTGGCTCTCATCTTGTGGCATTCGTTCGGTGTCATGACGTCGCTC
TTGCAGGAGATCATTTCCGTCTACACTCTCCTCAACCCTTCGCAGCTCACTGCTGCCGCTTCTAACAGGGTGTGC
AACGCACTGGCTCTGCTCCAGTGCGTCGCGTCGCACAACGATACTCGGGCTCTGTTCCTTAGTGCTCACATTCCC
CTCTTCCTCTATCCATTCCTCAACACGACGTCTAAGTCACGTCCTTTCGAATATCTTCGTTTGACGAGCTTGGGC
GTCATCGGCGCACTGGTCAAGAATGACTCGTCCGACGTCATCAACTTTCTCCTCACGACCGAGATCATCCCGCTC
TGCCTCCGTATCATGGAGACGGGTTCGGAGTTGAGCAAGACGGTGGCAATCTTTATCGTGCAGAAGATTCTGCTC
GACGACAACGGCCTCAACTACATCTGCGCCACGTACGAGCGCTTCTACGCCGTCGGCACCGTCTTGAGCAATATG
GTGGCCCAGCTGGTCGAGTCTCAGACCGCACGTCTCCTTAAGCACGTGGTCCGTTGCTTTCTCCGACTCAGCGAC
AACGCTCGGGCCCGCGAAGCCTTACGACAGTGCCTCCCCGAACCTCTTCGAGATGCCACCTTTTCGTCGGTGCTC
CGGGACGACGCAGCGACCAAAAGATGTCTCGCACAGCTGCTCATAAACCTATCAGATAACGTCGTTGATCCAGGG
GCTCAGCCCAGCATGTGA
Transcript >Ophcf2|01519
ATGATTCCATCGGCGCACGTCTACGGACACCATCCGTTCCAGGGCGGCGATTCACCCTGGCTTCACCACCAGCCT
GGCCATCACCAGCCTGGCCACCAGAGCCTCGGCCAGCAGCACCAGCAGCACCAGCAGCATCAGCACTTTGGCGCC
ATGGCTGTCAACCACTCTGCTGCTGCTGGCATGGCCGCCGCTCACGCTCAGGATGCGGCTCACGAGAATATTTCG
GAGGAGAACCGACGGACCATGGCCTTTATTGCCGACCTCCTCAACGAGAGTACCAGGGAGGCTGCCCTCTTGGAG
CTTAGCAAGAAACGCGAACAGGTCCCTGAGCTGGCTCTCATCTTGTGGCATTCGTTCGGTGTCATGACGTCGCTC
TTGCAGGAGATCATTTCCGTCTACACTCTCCTCAACCCTTCGCAGCTCACTGCTGCCGCTTCTAACAGGGTGTGC
AACGCACTGGCTCTGCTCCAGTGCGTCGCGTCGCACAACGATACTCGGGCTCTGTTCCTTAGTGCTCACATTCCC
CTCTTCCTCTATCCATTCCTCAACACGACGTCTAAGTCACGTCCTTTCGAATATCTTCGTTTGACGAGCTTGGGC
GTCATCGGCGCACTGGTCAAGAATGACTCGTCCGACGTCATCAACTTTCTCCTCACGACCGAGATCATCCCGCTC
TGCCTCCGTATCATGGAGACGGGTTCGGAGTTGAGCAAGACGGTGGCAATCTTTATCGTGCAGAAGATTCTGCTC
GACGACAACGGCCTCAACTACATCTGCGCCACGTACGAGCGCTTCTACGCCGTCGGCACCGTCTTGAGCAATATG
GTGGCCCAGCTGGTCGAGTCTCAGACCGCACGTCTCCTTAAGCACGTGGTCCGTTGCTTTCTCCGACTCAGCGAC
AACGCTCGGGCCCGCGAAGCCTTACGACAGTGCCTCCCCGAACCTCTTCGAGATGCCACCTTTTCGTCGGTGCTC
CGGGACGACGCAGCGACCAAAAGATGTCTCGCACAGCTGCTCATAAACCTATCAGATAACGTCGTTGATCCAGGG
GCTCAGCCCAGCATGTGA
Gene >Ophcf2|01519
ATGATTCCATCGGCGCACGTCTACGGACACCATCCGTTCCAGGGCGGCGATTCACCCTGGCTTCACCACCAGCCT
GGCCATCACCAGCCTGGCCACCAGAGCCTCGGCCAGCAGCACCAGCAGCACCAGCAGCATCAGCACTTTGGCGCC
ATGGCTGTCAACCACTCTGCTGCTGCTGGCATGGCCGCCGCTCACGCTCAGGATGCGGCTCACGAGAATATTTCG
GAGGAGAACCGACGGACCATGGCCTTTATTGCCGACCTCCTCAACGAGAGTACCAGGGAGGCTGCCCTCTTGGAG
CTTAGCAAGAAACGCGAACAGGTCCCTGAGCTGGCTCTCATCTTGTGGCATTCGTTCGGTATGCCAACTCGCTCG
CTCTTTTTTTTTTCTGACTGACTTTCCGATGGCTAATCTGTTGTAGGTGTCATGACGTCGCTCTTGCAGGAGATC
ATTTCCGTCTACACTCTCCTCAACCCTTCGCAGCTCACTGCTGCCGCTTCTAACAGGGTGTGCAACGCACTGGCT
CTGCTCCAGTGCGTCGCGTCGCACAACGATACTCGGGCTCTGTTCCTTAGTGGTGAGTCTCTTTGCACTTCTTCT
ACTCTCGCCTCGGTGACAGCTGCTGACCCACGTCACGGATAGCTCACATTCCCCTCTTCCTCTATCCATTCCTCA
ACACGACGTCTAAGTCACGTCCTTTCGAATATCTTCGTTTGACGAGCTTGGGCGTCATCGGCGCACTGGTCAAGA
ATGACTCGTCCGACGTCATCAACTTTCTCCTCACGACCGAGATCATCCCGCTCTGCCTCCGTATCATGGAGACGG
GTTCGGAGTTGAGCAAGACGGTGGCAATCTTTATCGTGCAGAAGATTCTGCTCGACGACAACGGCCTCAACTACA
TCTGCGCCACGTACGAGCGCTTCTACGCCGTCGGCACCGTCTTGAGCAATATGGTGGCCCAGCTGGTCGAGTCTC
AGACCGCACGTCTCCTTAAGCACGTGGTCCGTTGCTTTCTCCGGTAAGCAAGCTCTGAACCTTGAGGACGAGGAG
AGACTCGAGAGGGCTGACGACAATCATCCTGCAGACTCAGCGACAACGCTCGGGCCCGCGAAGCCTTACGACAGT
GCCTCCCCGAACCTCTTCGAGATGCCACCTTTTCGTCGGTGCTCCGGGACGACGCAGCGACCAAAAGATGTCTCG
CACAGCTGCTCATAAACCTATCAGATAACGTCGTTGATCCAGGGGCTCAGCCCAGCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail