Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01518
Gene name
Locationscaffold_01:5202513..5206324
Strand-
Gene length (bp)3811
Transcript length (bp)3744
Coding sequence length (bp)3744
Protein length (aa) 1248

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02194 PXA PXA domain 6.5E-47 99 282
PF08628 Nexin_C Sorting nexin C terminal 9.7E-26 1120 1226
PF00787 PX PX domain 3.1E-17 932 1008
PF00615 RGS Regulator of G protein signaling domain 2.1E-12 418 564

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0005543 phospholipid binding No
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01518
MALKRRQAVLGVAVAITACAYAWSPGVRWALYSFVAGFVVCVVAFFAVILTTARRPLEKRTLPRVAFLDSRRWRV
EVDARHKRQREHARPSTLDEALLSETVARRLDDLLGLVRRDFVCSWYSHISPNAVFPDEVDYCIRQTLFRLIETA
ARVDLADVITGRLMPILTAHFRDFNEAERSVRGRKLNRSVTESDELDLAIASKYRQGHLHDAASLSFSDTKMIQQ
DYLRGLVARVMPQLMPEGTHSSRIVSILVREIVACAVLFPVAQLLSDPDTWNQLMESYGRSMLQDRSTVRKLRAA
LDQHAHPTATPRAAKSAVAPRIASGDGERKFEKFIRGIRKVNNLSDARRFRSEVSSQLKRDLLEDNQDPVYLRRL
EMGKRLLDQRVDQLAAVGNPSLRSSLATSTTSASSSKLENASLVELLRDSSGLSYFMEYMDRQRLMPLVQFWLVV
DGFRNPLEDDAADEDNVDANGDDAASASSNLPMWKGSDRADLQQIHQAYLSKPELGVPDSTRQEVRQFLKAGSAA
TPAQYHRARQSILKAQSAVLAEMQSRYFQAFKKSDLYYKCLAAQEASSASAARSRAPSGLPEQVRQQQRPPPVRA
APSYLTKPKSFVRLATSQADSVSTKRSDSASDLRSLGGGEFSAASRRSLDDGPSSPGPLFGDDDVEHESLFGSVQ
SLDQNVSGQSVPDTKVVQAVEQALNNIMGDDRPQTAEDLRASLFGADDAESTIFSDRDNGSSRGGSIDAGRPPQA
TAMAGKDLEKPSISSLGLVSAASRIGVFVDDDLFDDSERHLPDETDEADDVTGAADEAEDEVHEAAPGDLGLAEA
IAALSNDIDRLVAQEAVVDSLTNKAELTNNASELRILRKSKASLQREIRRKELQRQQYVVQESDNSLYGRSTVRI
KSIQVGREDDGREFALYVVEVQRNAGEQMPAASWIVTRRYSEFHDLHQKLRFGYPSVRGLDFPRRRMVMKFQSEF
LRKRSAALEAYLRQLLLLPDVCRSRELRSFLSQSVVAQGQDMTDREDKKDMMTRLYDSVADGMDDILGNIPVLDQ
ISVAGQNLITAATSQLNSIPPGVSDVDAFPAAAEAEAELNAFEDKELTPFIKPICDIFLEIFGLNRGNNWLRGRA
VVMVLQQLLGGTIERKVRDNVRALVQEESLLRYMDLVTDSLWPGGELRREREPRAAAAKKATRTEASLMLATLVP
DLAGSVVGRANAQAASRRILATLNNARLNAHLVFSILDEVVAILFEG*
Coding >Ophcf2|01518
ATGGCGCTGAAGCGGAGACAGGCGGTCCTGGGCGTCGCCGTCGCTATTACCGCCTGTGCCTACGCGTGGTCTCCC
GGAGTCCGTTGGGCCCTATACAGTTTCGTCGCCGGCTTCGTCGTCTGCGTTGTCGCCTTTTTCGCTGTGATTTTG
ACGACGGCGCGGAGACCGCTGGAGAAGAGGACGTTGCCTCGCGTCGCTTTCCTTGACAGTCGGCGCTGGCGGGTG
GAGGTGGATGCACGACACAAACGTCAACGGGAGCACGCCCGGCCGTCGACCCTCGATGAAGCGCTTCTCTCGGAG
ACTGTGGCGCGCAGACTGGATGACTTGCTAGGATTAGTCCGGCGAGACTTCGTCTGCTCTTGGTATTCGCATATC
AGTCCGAATGCCGTCTTCCCAGACGAAGTCGACTACTGTATACGACAGACGCTGTTTAGGCTCATCGAGACAGCT
GCCCGGGTCGACCTGGCCGACGTCATCACCGGCCGTCTGATGCCCATCCTCACCGCCCACTTCCGCGACTTCAAC
GAGGCTGAGAGGTCGGTTCGCGGCCGGAAGCTCAACCGATCCGTCACCGAGTCGGACGAGCTGGACTTGGCCATC
GCCTCCAAGTACCGCCAGGGCCATCTGCACGACGCCGCTTCGCTTTCCTTCTCCGACACCAAGATGATACAGCAG
GATTACCTCCGCGGCTTGGTTGCCCGCGTCATGCCTCAGCTCATGCCGGAAGGGACGCACTCCAGCCGTATCGTC
TCCATCCTGGTGCGCGAGATCGTCGCCTGCGCTGTCCTCTTCCCCGTGGCGCAGCTGCTGTCGGACCCGGATACG
TGGAATCAGCTCATGGAGAGCTACGGCCGGTCCATGCTGCAGGATAGATCGACGGTGCGGAAGCTGAGGGCTGCG
CTTGATCAGCATGCGCATCCGACGGCGACGCCTCGCGCTGCCAAGTCGGCGGTTGCGCCTCGGATAGCTTCGGGT
GATGGGGAGCGCAAGTTTGAAAAGTTCATCCGTGGGATCCGCAAGGTCAATAATCTTTCTGATGCTCGTCGATTC
AGGAGCGAGGTCTCCAGTCAGCTTAAGCGGGATCTGCTCGAGGATAATCAGGATCCTGTCTATCTGCGGAGGTTG
GAGATGGGTAAGCGTCTGCTGGATCAGAGGGTTGATCAGCTTGCTGCCGTGGGGAATCCTTCTCTGCGCTCTTCG
CTAGCTACCTCTACCACTTCTGCCTCGTCTAGCAAGTTGGAAAACGCGTCTCTGGTCGAGCTGCTGCGCGACTCG
TCCGGGTTGTCGTACTTCATGGAATACATGGATCGTCAGCGACTGATGCCGCTCGTCCAATTCTGGCTGGTTGTC
GACGGCTTTCGGAATCCGTTAGAAGACGACGCGGCTGATGAGGATAACGTCGACGCCAACGGTGATGACGCTGCC
TCGGCCTCGTCTAACCTGCCCATGTGGAAGGGCTCGGACCGGGCAGACCTACAGCAGATTCACCAGGCATATCTT
TCCAAGCCTGAGCTGGGAGTTCCCGACTCGACCAGACAAGAGGTTCGCCAGTTCCTCAAGGCCGGCAGTGCCGCG
ACGCCGGCCCAATATCACAGGGCCCGGCAGTCTATCCTCAAGGCGCAGAGCGCTGTTCTCGCCGAGATGCAGTCT
CGGTACTTTCAGGCTTTCAAGAAGTCTGATCTATACTACAAGTGTCTCGCCGCTCAGGAGGCTTCCAGTGCCAGC
GCTGCTCGTTCCCGCGCTCCTTCGGGTCTGCCCGAGCAGGTTCGGCAGCAGCAGCGTCCGCCGCCAGTCAGGGCA
GCGCCGTCGTACTTGACCAAGCCCAAGTCCTTTGTCCGACTGGCGACCTCTCAAGCCGATTCCGTGTCGACGAAG
CGCTCCGATTCGGCCTCGGATCTGCGTTCGCTGGGCGGTGGCGAATTCTCGGCCGCATCCCGACGCTCCCTGGAC
GATGGACCTTCTTCCCCCGGACCCCTTTTCGGCGACGATGACGTCGAGCACGAGAGCCTGTTCGGGTCGGTTCAG
AGTCTGGATCAGAACGTGTCAGGGCAAAGCGTCCCGGACACCAAGGTGGTACAGGCCGTGGAGCAGGCCCTCAAC
AACATCATGGGAGACGACAGGCCGCAGACGGCCGAGGACCTGCGGGCCAGCCTCTTCGGCGCCGACGATGCCGAG
TCCACCATCTTCTCGGACCGCGACAACGGCTCGAGCCGGGGGGGCTCCATAGATGCCGGTAGACCGCCTCAAGCT
ACCGCCATGGCCGGCAAGGACCTCGAGAAGCCCAGCATCTCTTCCTTGGGCCTGGTCAGCGCCGCCTCGCGTATC
GGCGTCTTCGTCGATGACGATCTCTTCGACGATAGCGAAAGGCACCTGCCGGACGAGACGGATGAGGCCGACGAC
GTGACGGGCGCGGCCGACGAGGCAGAAGACGAGGTGCACGAGGCGGCACCCGGCGATCTTGGCCTGGCCGAGGCC
ATCGCGGCCCTTAGCAACGACATCGATCGGCTGGTGGCGCAGGAAGCCGTCGTCGACTCGCTGACCAACAAGGCC
GAGCTCACAAACAACGCGTCGGAGCTGCGAATCCTCCGCAAGTCCAAGGCGAGCCTGCAGCGGGAGATTCGGCGC
AAGGAACTCCAGCGGCAGCAGTACGTGGTGCAGGAGAGCGACAACAGCCTCTACGGCCGCTCCACCGTCCGCATC
AAGTCGATCCAGGTGGGCAGGGAGGACGACGGGCGCGAGTTCGCGCTGTACGTGGTCGAGGTGCAGCGCAACGCG
GGCGAGCAGATGCCGGCGGCATCCTGGATAGTTACGAGGCGATATAGCGAGTTCCACGATCTTCACCAGAAGCTG
AGGTTCGGCTACCCGTCCGTGAGGGGCCTCGACTTTCCGCGGCGGCGCATGGTGATGAAGTTTCAGAGCGAGTTC
CTCCGCAAGAGGAGCGCGGCGCTCGAGGCGTACCTCCGACAGCTGCTGCTGCTGCCGGACGTGTGTCGGAGCCGG
GAGCTGCGGTCGTTTCTATCGCAGAGCGTCGTGGCACAGGGTCAAGACATGACGGATCGCGAGGATAAGAAGGAC
ATGATGACGAGGTTGTACGACTCGGTGGCGGACGGCATGGATGACATCTTGGGCAACATCCCGGTGCTGGACCAG
ATATCGGTCGCGGGACAGAACCTCATCACGGCGGCGACGAGCCAGCTCAACTCGATACCGCCGGGCGTGAGCGAC
GTCGATGCTTTTCCGGCGGCTGCCGAGGCCGAGGCCGAGCTCAATGCCTTTGAGGATAAGGAGCTGACGCCATTT
ATCAAGCCCATCTGCGACATCTTCCTCGAGATCTTTGGCCTCAACCGCGGAAACAACTGGCTCCGCGGTCGGGCC
GTCGTCATGGTTCTCCAGCAGCTGCTGGGCGGCACCATCGAGCGCAAGGTACGAGACAACGTCAGGGCTTTGGTG
CAGGAGGAGTCGCTGCTGCGCTACATGGACTTGGTCACGGACAGCCTCTGGCCCGGCGGCGAGCTGCGCCGCGAG
AGGGAGCCTCGCGCGGCGGCGGCCAAGAAGGCGACGCGGACCGAGGCGAGCCTCATGCTGGCCACGCTGGTTCCC
GACTTGGCGGGGAGCGTCGTCGGGAGGGCTAATGCGCAAGCGGCCAGTCGGCGGATATTGGCGACGTTGAATAAC
GCTCGGCTTAATGCTCATCTGGTGTTTAGCATCCTGGATGAGGTCGTTGCGATATTGTTTGAGGGGTGA
Transcript >Ophcf2|01518
ATGGCGCTGAAGCGGAGACAGGCGGTCCTGGGCGTCGCCGTCGCTATTACCGCCTGTGCCTACGCGTGGTCTCCC
GGAGTCCGTTGGGCCCTATACAGTTTCGTCGCCGGCTTCGTCGTCTGCGTTGTCGCCTTTTTCGCTGTGATTTTG
ACGACGGCGCGGAGACCGCTGGAGAAGAGGACGTTGCCTCGCGTCGCTTTCCTTGACAGTCGGCGCTGGCGGGTG
GAGGTGGATGCACGACACAAACGTCAACGGGAGCACGCCCGGCCGTCGACCCTCGATGAAGCGCTTCTCTCGGAG
ACTGTGGCGCGCAGACTGGATGACTTGCTAGGATTAGTCCGGCGAGACTTCGTCTGCTCTTGGTATTCGCATATC
AGTCCGAATGCCGTCTTCCCAGACGAAGTCGACTACTGTATACGACAGACGCTGTTTAGGCTCATCGAGACAGCT
GCCCGGGTCGACCTGGCCGACGTCATCACCGGCCGTCTGATGCCCATCCTCACCGCCCACTTCCGCGACTTCAAC
GAGGCTGAGAGGTCGGTTCGCGGCCGGAAGCTCAACCGATCCGTCACCGAGTCGGACGAGCTGGACTTGGCCATC
GCCTCCAAGTACCGCCAGGGCCATCTGCACGACGCCGCTTCGCTTTCCTTCTCCGACACCAAGATGATACAGCAG
GATTACCTCCGCGGCTTGGTTGCCCGCGTCATGCCTCAGCTCATGCCGGAAGGGACGCACTCCAGCCGTATCGTC
TCCATCCTGGTGCGCGAGATCGTCGCCTGCGCTGTCCTCTTCCCCGTGGCGCAGCTGCTGTCGGACCCGGATACG
TGGAATCAGCTCATGGAGAGCTACGGCCGGTCCATGCTGCAGGATAGATCGACGGTGCGGAAGCTGAGGGCTGCG
CTTGATCAGCATGCGCATCCGACGGCGACGCCTCGCGCTGCCAAGTCGGCGGTTGCGCCTCGGATAGCTTCGGGT
GATGGGGAGCGCAAGTTTGAAAAGTTCATCCGTGGGATCCGCAAGGTCAATAATCTTTCTGATGCTCGTCGATTC
AGGAGCGAGGTCTCCAGTCAGCTTAAGCGGGATCTGCTCGAGGATAATCAGGATCCTGTCTATCTGCGGAGGTTG
GAGATGGGTAAGCGTCTGCTGGATCAGAGGGTTGATCAGCTTGCTGCCGTGGGGAATCCTTCTCTGCGCTCTTCG
CTAGCTACCTCTACCACTTCTGCCTCGTCTAGCAAGTTGGAAAACGCGTCTCTGGTCGAGCTGCTGCGCGACTCG
TCCGGGTTGTCGTACTTCATGGAATACATGGATCGTCAGCGACTGATGCCGCTCGTCCAATTCTGGCTGGTTGTC
GACGGCTTTCGGAATCCGTTAGAAGACGACGCGGCTGATGAGGATAACGTCGACGCCAACGGTGATGACGCTGCC
TCGGCCTCGTCTAACCTGCCCATGTGGAAGGGCTCGGACCGGGCAGACCTACAGCAGATTCACCAGGCATATCTT
TCCAAGCCTGAGCTGGGAGTTCCCGACTCGACCAGACAAGAGGTTCGCCAGTTCCTCAAGGCCGGCAGTGCCGCG
ACGCCGGCCCAATATCACAGGGCCCGGCAGTCTATCCTCAAGGCGCAGAGCGCTGTTCTCGCCGAGATGCAGTCT
CGGTACTTTCAGGCTTTCAAGAAGTCTGATCTATACTACAAGTGTCTCGCCGCTCAGGAGGCTTCCAGTGCCAGC
GCTGCTCGTTCCCGCGCTCCTTCGGGTCTGCCCGAGCAGGTTCGGCAGCAGCAGCGTCCGCCGCCAGTCAGGGCA
GCGCCGTCGTACTTGACCAAGCCCAAGTCCTTTGTCCGACTGGCGACCTCTCAAGCCGATTCCGTGTCGACGAAG
CGCTCCGATTCGGCCTCGGATCTGCGTTCGCTGGGCGGTGGCGAATTCTCGGCCGCATCCCGACGCTCCCTGGAC
GATGGACCTTCTTCCCCCGGACCCCTTTTCGGCGACGATGACGTCGAGCACGAGAGCCTGTTCGGGTCGGTTCAG
AGTCTGGATCAGAACGTGTCAGGGCAAAGCGTCCCGGACACCAAGGTGGTACAGGCCGTGGAGCAGGCCCTCAAC
AACATCATGGGAGACGACAGGCCGCAGACGGCCGAGGACCTGCGGGCCAGCCTCTTCGGCGCCGACGATGCCGAG
TCCACCATCTTCTCGGACCGCGACAACGGCTCGAGCCGGGGGGGCTCCATAGATGCCGGTAGACCGCCTCAAGCT
ACCGCCATGGCCGGCAAGGACCTCGAGAAGCCCAGCATCTCTTCCTTGGGCCTGGTCAGCGCCGCCTCGCGTATC
GGCGTCTTCGTCGATGACGATCTCTTCGACGATAGCGAAAGGCACCTGCCGGACGAGACGGATGAGGCCGACGAC
GTGACGGGCGCGGCCGACGAGGCAGAAGACGAGGTGCACGAGGCGGCACCCGGCGATCTTGGCCTGGCCGAGGCC
ATCGCGGCCCTTAGCAACGACATCGATCGGCTGGTGGCGCAGGAAGCCGTCGTCGACTCGCTGACCAACAAGGCC
GAGCTCACAAACAACGCGTCGGAGCTGCGAATCCTCCGCAAGTCCAAGGCGAGCCTGCAGCGGGAGATTCGGCGC
AAGGAACTCCAGCGGCAGCAGTACGTGGTGCAGGAGAGCGACAACAGCCTCTACGGCCGCTCCACCGTCCGCATC
AAGTCGATCCAGGTGGGCAGGGAGGACGACGGGCGCGAGTTCGCGCTGTACGTGGTCGAGGTGCAGCGCAACGCG
GGCGAGCAGATGCCGGCGGCATCCTGGATAGTTACGAGGCGATATAGCGAGTTCCACGATCTTCACCAGAAGCTG
AGGTTCGGCTACCCGTCCGTGAGGGGCCTCGACTTTCCGCGGCGGCGCATGGTGATGAAGTTTCAGAGCGAGTTC
CTCCGCAAGAGGAGCGCGGCGCTCGAGGCGTACCTCCGACAGCTGCTGCTGCTGCCGGACGTGTGTCGGAGCCGG
GAGCTGCGGTCGTTTCTATCGCAGAGCGTCGTGGCACAGGGTCAAGACATGACGGATCGCGAGGATAAGAAGGAC
ATGATGACGAGGTTGTACGACTCGGTGGCGGACGGCATGGATGACATCTTGGGCAACATCCCGGTGCTGGACCAG
ATATCGGTCGCGGGACAGAACCTCATCACGGCGGCGACGAGCCAGCTCAACTCGATACCGCCGGGCGTGAGCGAC
GTCGATGCTTTTCCGGCGGCTGCCGAGGCCGAGGCCGAGCTCAATGCCTTTGAGGATAAGGAGCTGACGCCATTT
ATCAAGCCCATCTGCGACATCTTCCTCGAGATCTTTGGCCTCAACCGCGGAAACAACTGGCTCCGCGGTCGGGCC
GTCGTCATGGTTCTCCAGCAGCTGCTGGGCGGCACCATCGAGCGCAAGGTACGAGACAACGTCAGGGCTTTGGTG
CAGGAGGAGTCGCTGCTGCGCTACATGGACTTGGTCACGGACAGCCTCTGGCCCGGCGGCGAGCTGCGCCGCGAG
AGGGAGCCTCGCGCGGCGGCGGCCAAGAAGGCGACGCGGACCGAGGCGAGCCTCATGCTGGCCACGCTGGTTCCC
GACTTGGCGGGGAGCGTCGTCGGGAGGGCTAATGCGCAAGCGGCCAGTCGGCGGATATTGGCGACGTTGAATAAC
GCTCGGCTTAATGCTCATCTGGTGTTTAGCATCCTGGATGAGGTCGTTGCGATATTGTTTGAGGGGTGA
Gene >Ophcf2|01518
ATGGCGCTGAAGCGGAGACAGGCGGTCCTGGGCGTCGCCGTCGCTATTACCGCCTGTGCCTACGCGTGGTCTCCC
GGAGTCCGTTGGGCCCTATACAGTTTCGTCGCCGGCTTCGTCGTCTGCGTTGTCGCCTTTTTCGCTGTGATTTTG
ACGACGGCGCGGAGACCGCTGGAGAAGAGGACGTTGCCTCGCGTCGCTTTCCTTGACAGTCGGCGCTGGCGGGTG
GAGGTGGATGCACGACACAAACGTCAACGGGAGCACGCCCGGCCGTCGACCCTCGATGAAGCGCTTCTCTCGGAG
ACTGTGGCGCGCAGACTGGATGACTTGCTAGGATTAGTCCGGCGAGACTTCGTCTGCTCTTGGTATTCGCATATC
AGTCCGAATGCCGTCTTCCCAGACGAAGTCGACTACTGTATACGACAGACGCTGTTTAGGCTCATCGAGACAGCT
GCCCGGGTCGACCTGGCCGACGTCATCACCGGCCGTCTGATGCCCATCCTCACCGCCCACTTCCGCGACTTCAAC
GAGGCTGAGAGGTCGGTTCGCGGCCGGAAGCTCAACCGATCCGTCACCGAGTCGGACGAGCTGGACTTGGCCATC
GCCTCCAAGTACCGCCAGGGCCATCTGCACGACGCCGCTTCGCTTTCCTTCTCCGACACCAAGATGATACAGCAG
GATTACCTCCGCGGCTTGGTTGCCCGCGTCATGCCTCAGCTCATGCCGGAAGGGACGCACTCCAGCCGTATCGTC
TCCATCCTGGTGCGCGAGATCGTCGCCTGCGCTGTCCTCTTCCCCGTGGCGCAGCTGCTGTCGGACCCGGATACG
TGGAATCAGCTCATGGAGAGCTACGGCCGGTCCATGCTGCAGGATAGATCGACGGTGCGGAAGCTGAGGGCTGCG
CTTGATCAGCATGCGCATCCGACGGCGACGCCTCGCGCTGCCAAGTCGGCGGTTGCGCCTCGGATAGCTTCGGGT
GATGGGGAGCGCAAGTTTGAAAAGTTCATCCGTGGGATCCGCAAGGTCAATAATCTTTCTGATGCTCGTCGATTC
AGGAGCGAGGTCTCCAGTCAGCTTAAGCGGGATCTGCTCGAGGATAATCAGGATCCTGTCTATCTGCGGAGGTTG
GAGATGGGTAAGCGTCTGCTGGATCAGAGGGTTGATCAGCTTGCTGCCGTGGGGAATCCTTCTCTGCGCTCTTCG
CTAGCTACCTCTACCACTTCTGCCTCGTCTAGCAAGTTGGAAAACGCGTCTCTGGTCGAGCTGCTGCGCGACTCG
TCCGGGTTGTCGTACTTCATGGAATACATGGATCGTCAGCGACTGATGCCGCTCGTCCAATTCTGGCTGGTTGTC
GACGGCTTTCGGAATCCGTTAGAAGACGACGCGGCTGATGAGGATAACGTCGACGCCAACGGTGATGACGCTGCC
TCGGCCTCGTCTAACCTGCCCATGTGGAAGGGCTCGGACCGGGCAGACCTACAGCAGATTCACCAGGCATATCTT
TCCAAGCCTGAGCTGGGAGTTCCCGACTCGACCAGACAAGAGGTTCGCCAGTTCCTCAAGGCCGGCAGTGCCGCG
ACGCCGGCCCAATATCACAGGGCCCGGCAGTCTATCCTCAAGGCGCAGAGCGCTGTTCTCGCCGAGATGCAGTCT
CGGTACTTTCAGGCTTTCAAGAAGTCTGATCTATACTACAAGTGTCTCGCCGCTCAGGAGGCTTCCAGTGCCAGC
GCTGCTCGTTCCCGCGCTCCTTCGGGTCTGCCCGAGCAGGTTCGGCAGCAGCAGCGTCCGCCGCCAGTCAGGGCA
GCGCCGTCGTACTTGACCAAGCCCAAGTCCTTTGTCCGACTGGCGACCTCTCAAGCCGATTCCGTGTCGACGAAG
CGCTCCGATTCGGCCTCGGATCTGCGTTCGCTGGGCGGTGGCGAATTCTCGGCCGCATCCCGACGCTCCCTGGAC
GATGGACCTTCTTCCCCCGGACCCCTTTTCGGCGACGATGACGTCGAGCACGAGAGCCTGTTCGGGTCGGTTCAG
AGTCTGGATCAGAACGTGTCAGGGCAAAGCGTCCCGGACACCAAGGTGGTACAGGCCGTGGAGCAGGCCCTCAAC
AACATCATGGGAGACGACAGGCCGCAGACGGCCGAGGACCTGCGGGCCAGCCTCTTCGGCGCCGACGATGCCGAG
TCCACCATCTTCTCGGACCGCGACAACGGCTCGAGCCGGGGGGGCTCCATAGATGCCGGTAGACCGCCTCAAGCT
ACCGCCATGGCCGGCAAGGACCTCGAGAAGCCCAGCATCTCTTCCTTGGGCCTGGTCAGCGCCGCCTCGCGTATC
GGCGTCTTCGTCGATGACGATCTCTTCGACGATAGCGAAAGGCACCTGCCGGACGAGACGGATGAGGCCGACGAC
GTGACGGGCGCGGCCGACGAGGCAGAAGACGAGGTGCACGAGGCGGCACCCGGCGATCTTGGCCTGGCCGAGGCC
ATCGCGGCCCTTAGCAACGACATCGATCGGCTGGTGGCGCAGGAAGCCGTCGTCGACTCGCTGACCAACAAGGCC
GAGCTCACAAACAACGCGTCGGAGCTGCGAATCCTCCGCAAGTCCAAGGCGAGCCTGCAGCGGGAGATTCGGCGC
AAGGAACTCCAGCGGCAGCAGTACGTGGTGCAGGAGAGCGACAACAGCCTCTACGGCCGCTCCACCGTCCGCATC
AAGTCGATCCAGGTGGGCAGGGAGGACGACGGGCGCGAGTTCGCGCTGTACGTGGTCGAGGTGCAGCGCAACGCG
GGCGAGCAGATGCCGGCGGCATCCTGGATAGTTACGAGGCGATATAGCGAGTTCCACGATCTTCACCAGAAGCTG
AGGTTCGGCTACCCGTCCGTGAGGGGCCTCGACTTTCCGCGGCGGCGCATGGTGATGAAGTTTCAGAGCGAGTTC
CTCCGCAAGAGGAGCGCGGCGCTCGAGGCGTACCTCCGACAGCTGCTGCTGCTGCCGGACGTGTGTCGGAGCCGG
GAGCTGCGGTCGTTTCTATCGCAGAGCGTCGTGGCACAGGGTCAAGACATGACGGATCGCGAGGATAAGAAGGAC
ATGATGACGAGGTTGTACGACTCGGTGGCGGACGGCATGGATGACATCTTGGGCAACATCCCGGTGCTGGACCAG
ATATCGGTCGCGGGACAGAACCTCATCACGGCGGCGACGAGCCAGCTCAACTCGATACCGCCGGGCGTGAGCGAC
GTCGATGCTTTTCCGGCGGCTGCCGAGGCCGAGGCCGAGCTCAATGCCTTTGAGGATAAGGAGCTGACGCCATTT
ATCAAGCCCATCTGCGACATCTTCCTCGAGATCTTTGGCCTCAACCGCGGAAACAACTGGCTCCGCGGTCGGGCC
GTCGTCATGGTTCTCCAGCAGCTGCTGGGCGGCACCATCGAGCGCAAGGTACGAGACAACGTCAGGGCTTTGGTG
CAGGAGGAGTCGCTGCTGCGCTACATGGACTTGGTCACGGACAGCCTCTGGCCCGGCGGCGAGCTGCGCCGCGAG
AGGGAGCCTCGCGCGGCGGCGGCCAAGAAGGCGACGCGGACCGAGGCGAGCCTCATGCTGGCCACGCTGGTTCCC
GACTTGGCGGGGAGCGTCGTCGGGAGGGCTAATGCGCAAGCGGCCAGTCGGCGGATATTGGCGACGTTGAATAAC
GCTCGGCTTAAGTGAGTGGGTTTTTTTTTTCAGGGGAGGGGTGAGAGGAAGGGGAAGCTGACGGTGTTTTCTCGA
CAGTGCTCATCTGGTGTTTAGCATCCTGGATGAGGTCGTTGCGATATTGTTTGAGGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail