Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01510
Gene name
Locationscaffold_01:5186718..5187679
Strand+
Gene length (bp)961
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02390 Methyltransf_4 Putative methyltransferase 1.8E-53 81 257

GO

GO Term Description Terminal node
GO:0006400 tRNA modification Yes
GO:0008176 tRNA (guanine-N7-)-methyltransferase activity Yes
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043170 macromolecule metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0008033 tRNA processing No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008173 RNA methyltransferase activity No
GO:0009987 cellular process No
GO:0008168 methyltransferase activity No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0034470 ncRNA processing No
GO:0071704 organic substance metabolic process No
GO:0016423 tRNA (guanine) methyltransferase activity No
GO:0006399 tRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0009451 RNA modification No
GO:0043412 macromolecule modification No
GO:0003824 catalytic activity No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008175 tRNA methyltransferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5311 0.7319 0.0109 0.0327 0.2986 0.022 0.0789 0.1235 0.041 0.0053

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5643
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6314
Ophiocordyceps australis map64 (Brazil) OphauB2|1803
Ophiocordyceps camponoti-floridani Ophcf2|01510 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7617
Ophiocordyceps kimflemingae Ophio5|1650
Ophiocordyceps subramaniannii Hirsu2|7913

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01510
MVGPANKRANRQKFLAHKASHGAAQLPQKRYYRQRAHANPFSDHTLDYPVSPSAMDWSRYYPAWLDEEGQESGEV
KRLRKEVEVVDIGCGFGGLLVALAPLMPDTLMLGMEIRASVTEFVQERIWALREQSGGKQYQNAACLRANSMKFL
PNFFSKAQLSKIFICFPDPHFKTRKHKARIVSTTLNSEYAFVLRPGGIVYTITDVEALHEWMVRHFDGHAAFERV
SDEEEQSDDCVRVMMSETEEGKKVERNKGHKFVALFRRLEDGPW*
Coding >Ophcf2|01510
ATGGTCGGACCAGCTAACAAGCGCGCAAACCGCCAAAAGTTTCTCGCTCACAAGGCCAGCCATGGCGCCGCCCAG
CTGCCGCAGAAGCGATACTACCGCCAGCGCGCCCACGCGAATCCCTTCTCCGATCACACGCTGGACTATCCAGTC
TCGCCGTCGGCTATGGATTGGTCCAGATATTATCCAGCTTGGCTGGATGAGGAAGGTCAAGAGTCTGGGGAGGTG
AAACGGCTGAGAAAAGAGGTGGAAGTCGTTGATATTGGCTGTGGCTTTGGAGGTCTGCTCGTCGCGTTGGCTCCT
CTCATGCCTGACACACTCATGTTGGGCATGGAGATCCGGGCCAGCGTCACCGAGTTCGTCCAGGAACGGATATGG
GCCCTCCGTGAGCAAAGCGGCGGAAAGCAATACCAAAACGCGGCATGCCTACGAGCCAACTCGATGAAGTTCCTT
CCCAACTTCTTCTCCAAGGCCCAGCTATCCAAGATATTCATCTGCTTCCCCGATCCGCACTTCAAGACACGCAAG
CACAAGGCCAGGATCGTGTCGACGACGCTCAACTCCGAGTACGCCTTTGTGCTGCGTCCCGGCGGCATCGTCTAC
ACCATTACCGACGTCGAGGCGCTGCACGAGTGGATGGTGCGGCACTTTGATGGCCATGCTGCCTTTGAGCGGGTA
TCGGATGAGGAGGAGCAGTCTGACGATTGTGTGCGCGTCATGATGAGCGAGACGGAGGAGGGGAAAAAGGTGGAG
AGGAATAAGGGGCACAAGTTTGTTGCTCTGTTCCGTCGGCTGGAAGATGGACCTTGGTGA
Transcript >Ophcf2|01510
ATGGTCGGACCAGCTAACAAGCGCGCAAACCGCCAAAAGTTTCTCGCTCACAAGGCCAGCCATGGCGCCGCCCAG
CTGCCGCAGAAGCGATACTACCGCCAGCGCGCCCACGCGAATCCCTTCTCCGATCACACGCTGGACTATCCAGTC
TCGCCGTCGGCTATGGATTGGTCCAGATATTATCCAGCTTGGCTGGATGAGGAAGGTCAAGAGTCTGGGGAGGTG
AAACGGCTGAGAAAAGAGGTGGAAGTCGTTGATATTGGCTGTGGCTTTGGAGGTCTGCTCGTCGCGTTGGCTCCT
CTCATGCCTGACACACTCATGTTGGGCATGGAGATCCGGGCCAGCGTCACCGAGTTCGTCCAGGAACGGATATGG
GCCCTCCGTGAGCAAAGCGGCGGAAAGCAATACCAAAACGCGGCATGCCTACGAGCCAACTCGATGAAGTTCCTT
CCCAACTTCTTCTCCAAGGCCCAGCTATCCAAGATATTCATCTGCTTCCCCGATCCGCACTTCAAGACACGCAAG
CACAAGGCCAGGATCGTGTCGACGACGCTCAACTCCGAGTACGCCTTTGTGCTGCGTCCCGGCGGCATCGTCTAC
ACCATTACCGACGTCGAGGCGCTGCACGAGTGGATGGTGCGGCACTTTGATGGCCATGCTGCCTTTGAGCGGGTA
TCGGATGAGGAGGAGCAGTCTGACGATTGTGTGCGCGTCATGATGAGCGAGACGGAGGAGGGGAAAAAGGTGGAG
AGGAATAAGGGGCACAAGTTTGTTGCTCTGTTCCGTCGGCTGGAAGATGGACCTTGGTGA
Gene >Ophcf2|01510
ATGGTCGGACCAGCTAACAAGCGCGCAAACCGCCAAAAGTTTCTCGCTCACAAGGCCAGCCATGGCGCCGCCCAG
CTGCCGCAGAAGCGATACTACCGCCAGCGCGCCCACGCGAATCCCTTCTCCGATCACACGCTGGACTAGTATGTT
GTTGTTGTTGTTGTTGTTGTTGTTGTTGTTGCGCCCGGGGGAGGGGGAGACAAGCTTCCTTCTGACCGTGTGTTT
CTCGTTTAGTCCAGTCTCGCCGTCGGCTATGGATTGGTCCAGATATTATCCAGCTTGGCTGGATGAGGAAGGTCA
AGAGTCTGGGGAGGTGAAACGGCTGAGAAAAGAGGTGGAAGTCGTTGATATTGGCTGTGGCTTTGGAGGTCTGCT
CGTCGCGTTGGCTCCTCTCATGCCTGACACACTCATGTTGGGTAAGTATAAGAAGCCCAAAGGTTTATCATCTCA
CGGCTGACACGTGCCCGCCGCTTTAGGCATGGAGATCCGGGCCAGCGTCACCGAGTTCGTCCAGGAACGGATATG
GGCCCTCCGTGAGCAAAGCGGCGGAAAGCAATACCAAAACGCGGCATGCCTACGAGCCAACTCGATGAAGTTCCT
TCCCAACTTCTTCTCCAAGGCCCAGCTATCCAAGATATTCATCTGCTTCCCCGATCCGCACTTCAAGACACGCAA
GCACAAGGCCAGGATCGTGTCGACGACGCTCAACTCCGAGTACGCCTTTGTGCTGCGTCCCGGCGGCATCGTCTA
CACCATTACCGACGTCGAGGCGCTGCACGAGTGGATGGTGCGGCACTTTGATGGCCATGCTGCCTTTGAGCGGGT
ATCGGATGAGGAGGAGCAGTCTGACGATTGTGTGCGCGTCATGATGAGCGAGACGGAGGAGGGGAAAAAGGTGGA
GAGGAATAAGGGGCACAAGTTTGTTGCTCTGTTCCGTCGGCTGGAAGATGGACCTTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail