Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01508
Gene name
Locationscaffold_01:5184871..5186038
Strand+
Gene length (bp)1167
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00742 Homoserine_dh Homoserine dehydrogenase 2.7E-50 155 358
PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain 2.3E-16 13 147

GO

GO Term Description Terminal node
GO:0006520 cellular amino acid metabolic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0050661 NADP binding Yes
GO:0097159 organic cyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 109.06 62.72 155.40
Alive In ants, during behavior modification 89.24 51.00 127.47
Dead In ants, recently dead 74.44 41.99 106.88

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.302695 no
Alive Dead 0.286245 no
Dead Fungus 0.037163 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01508
MSAPNRVLIAVIGVGGVGKCFLSQLRLLAARRPSPKLSLCYISSSRKALYNDDYSEIAVEGVIEALAASRKAPPS
LPEVVEYLAAAPDKVILVDNTSSQHVADAYPLALGLGVNIVTPNKKAFSGPYELWQDILAASTASGAKFYHESSV
GAGLPVISTLRDLIDTGDKVTKIEGVFSGTMSFLFNSFAPTDGQGGAWSAEVIKAKALGYTEPDPRDDLNGLDVA
RKLTILARLVGLPIQSPTSFPVQSLIPKELESCQSGDEFLEKLAAFDSQMEVTKSAAEMEGKVVRFVGSIDVGTK
QVKVGLDMFEPSHPIAALKGSDNIISFYTERYGSNPLIVQGAGAGGEVTAMGVTADMLKVVAQIS*
Coding >Ophcf2|01508
ATGAGCGCCCCAAACAGAGTCTTGATCGCCGTCATCGGCGTCGGCGGCGTGGGCAAATGCTTCCTCTCTCAGCTG
CGATTGCTGGCCGCGCGCAGACCGTCACCGAAGCTCAGTCTTTGCTACATCTCGTCCAGTCGCAAGGCTCTGTAC
AATGATGATTACTCCGAGATCGCCGTCGAGGGCGTCATCGAGGCTCTGGCCGCGTCGAGAAAAGCCCCCCCTTCG
CTCCCCGAAGTCGTCGAGTATCTCGCTGCTGCTCCCGACAAGGTGATACTCGTCGACAACACCAGCTCGCAGCAT
GTTGCCGATGCGTACCCGCTCGCTCTCGGCCTGGGCGTCAACATCGTCACTCCCAATAAAAAGGCTTTCTCCGGT
CCCTACGAGCTCTGGCAGGACATCCTGGCCGCGTCGACCGCGTCTGGCGCCAAGTTCTACCACGAGTCGTCCGTC
GGTGCCGGCTTGCCCGTCATCTCGACGCTAAGGGACCTGATAGACACGGGCGACAAGGTGACCAAGATCGAGGGT
GTATTCAGCGGCACCATGTCTTTCCTCTTCAATTCCTTCGCCCCCACCGACGGGCAAGGCGGCGCCTGGTCAGCC
GAGGTCATCAAGGCCAAGGCGCTCGGCTACACCGAACCGGACCCGCGCGATGACCTCAACGGACTCGACGTCGCT
CGCAAGTTGACGATTCTGGCCCGCCTCGTCGGCCTCCCGATACAATCTCCGACGTCGTTTCCCGTCCAGAGTCTC
ATCCCGAAGGAGCTCGAGTCCTGTCAGAGCGGCGACGAGTTTCTCGAAAAGCTCGCCGCCTTTGATAGTCAGATG
GAGGTGACCAAGTCCGCGGCGGAGATGGAGGGCAAGGTGGTCCGGTTCGTGGGCAGCATCGATGTGGGCACCAAA
CAGGTCAAGGTTGGACTGGACATGTTTGAGCCGTCGCATCCGATTGCGGCGCTCAAGGGAAGCGACAACATCATA
AGCTTCTACACCGAGAGATACGGAAGCAATCCCCTGATTGTACAGGGTGCCGGGGCGGGGGGCGAGGTGACGGCA
ATGGGCGTGACGGCCGACATGCTCAAGGTGGTGGCGCAAATCTCATAG
Transcript >Ophcf2|01508
ATGAGCGCCCCAAACAGAGTCTTGATCGCCGTCATCGGCGTCGGCGGCGTGGGCAAATGCTTCCTCTCTCAGCTG
CGATTGCTGGCCGCGCGCAGACCGTCACCGAAGCTCAGTCTTTGCTACATCTCGTCCAGTCGCAAGGCTCTGTAC
AATGATGATTACTCCGAGATCGCCGTCGAGGGCGTCATCGAGGCTCTGGCCGCGTCGAGAAAAGCCCCCCCTTCG
CTCCCCGAAGTCGTCGAGTATCTCGCTGCTGCTCCCGACAAGGTGATACTCGTCGACAACACCAGCTCGCAGCAT
GTTGCCGATGCGTACCCGCTCGCTCTCGGCCTGGGCGTCAACATCGTCACTCCCAATAAAAAGGCTTTCTCCGGT
CCCTACGAGCTCTGGCAGGACATCCTGGCCGCGTCGACCGCGTCTGGCGCCAAGTTCTACCACGAGTCGTCCGTC
GGTGCCGGCTTGCCCGTCATCTCGACGCTAAGGGACCTGATAGACACGGGCGACAAGGTGACCAAGATCGAGGGT
GTATTCAGCGGCACCATGTCTTTCCTCTTCAATTCCTTCGCCCCCACCGACGGGCAAGGCGGCGCCTGGTCAGCC
GAGGTCATCAAGGCCAAGGCGCTCGGCTACACCGAACCGGACCCGCGCGATGACCTCAACGGACTCGACGTCGCT
CGCAAGTTGACGATTCTGGCCCGCCTCGTCGGCCTCCCGATACAATCTCCGACGTCGTTTCCCGTCCAGAGTCTC
ATCCCGAAGGAGCTCGAGTCCTGTCAGAGCGGCGACGAGTTTCTCGAAAAGCTCGCCGCCTTTGATAGTCAGATG
GAGGTGACCAAGTCCGCGGCGGAGATGGAGGGCAAGGTGGTCCGGTTCGTGGGCAGCATCGATGTGGGCACCAAA
CAGGTCAAGGTTGGACTGGACATGTTTGAGCCGTCGCATCCGATTGCGGCGCTCAAGGGAAGCGACAACATCATA
AGCTTCTACACCGAGAGATACGGAAGCAATCCCCTGATTGTACAGGGTGCCGGGGCGGGGGGCGAGGTGACGGCA
ATGGGCGTGACGGCCGACATGCTCAAGGTGGTGGCGCAAATCTCATAG
Gene >Ophcf2|01508
ATGAGCGCCCCAAACAGAGTCTTGATCGCCGTCATCGGTCGGTCCGCCCGCGTCTGTCTCGGGCCAAAGAGCCGC
CGCTGACCAGGAATTTCTTCGCTCTTCCCAGGCGTCGGCGGCGTGGGCAAATGCTTCCTCTCTCAGCTGCGATTG
CTGGCCGCGCGCAGACCGTCACCGAAGCTCAGTCTTTGCTACATCTCGTCCAGTCGCAAGGCTCTGTACAATGAT
GATTACTCCGAGATCGCCGTCGAGGGCGTCATCGAGGCTCTGGCCGCGTCGAGAAAAGCCCCCCCTTCGCTCCCC
GAAGTCGTCGAGTATCTCGCTGCTGCTCCCGACAAGGTGATACTCGTCGACAACACCAGCTCGCAGCATGTTGCC
GATGCGTACCCGCTCGCTCTCGGCCTGGGCGTCAACATCGTCACTCCCAATAAAAAGGCTTTCTCCGGTCCCTAC
GAGCTCTGGCAGGACATCCTGGCCGCGTCGACCGCGTCTGGCGCCAAGTTCTACCACGAGTCGTCCGTCGGTGCC
GGCTTGCCCGTCATCTCGACGCTAAGGGACCTGATAGACACGGGCGACAAGGTGACCAAGATCGAGGGTGTATTC
AGCGGCACCATGTCTTTCCTCTTCAATTCCTTCGCCCCCACCGACGGGCAAGGCGGCGCCTGGTCAGCCGAGGTC
ATCAAGGCCAAGGCGCTCGGCTACACCGAACCGGACCCGCGCGATGACCTCAACGGACTCGACGTCGCTCGCAAG
TTGACGATTCTGGCCCGCCTCGTCGGCCTCCCGATACAATCTCCGACGTCGTTTCCCGTCCAGAGTCTCATCCCG
AAGGAGCTCGAGTCCTGTCAGAGCGGCGACGAGTTTCTCGAAAAGCTCGCCGCCTTTGATAGTCAGATGGAGGTG
ACCAAGTCCGCGGCGGAGATGGAGGGCAAGGTGGTCCGGTTCGTGGGCAGCATCGATGTGGGCACCAAACAGGTC
AAGGTTGGACTGGACATGTTTGAGCCGTCGCATCCGATTGCGGCGCTCAAGGGAAGCGACAACATCATAAGCTTC
TACACCGAGAGATACGGAAGCAATCCCCTGATTGTACAGGGTGCCGGGGCGGGGGGCGAGGTGACGGCAATGGGC
GTGACGGCCGACATGCTCAAGGTGGTGGCGCAAATCTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail