Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01508
Gene name
Locationscaffold_01:5184871..5186038
Strand+
Gene length (bp)1167
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00742 Homoserine_dh Homoserine dehydrogenase 2.7E-50 155 358
PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain 2.3E-16 13 147

GO

GO Term Description Terminal node
GO:0006520 cellular amino acid metabolic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0050661 NADP binding Yes
GO:0097159 organic cyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01508
MSAPNRVLIAVIGVGGVGKCFLSQLRLLAARRPSPKLSLCYISSSRKALYNDDYSEIAVEGVIEALAASRKAPPS
LPEVVEYLAAAPDKVILVDNTSSQHVADAYPLALGLGVNIVTPNKKAFSGPYELWQDILAASTASGAKFYHESSV
GAGLPVISTLRDLIDTGDKVTKIEGVFSGTMSFLFNSFAPTDGQGGAWSAEVIKAKALGYTEPDPRDDLNGLDVA
RKLTILARLVGLPIQSPTSFPVQSLIPKELESCQSGDEFLEKLAAFDSQMEVTKSAAEMEGKVVRFVGSIDVGTK
QVKVGLDMFEPSHPIAALKGSDNIISFYTERYGSNPLIVQGAGAGGEVTAMGVTADMLKVVAQIS*
Coding >Ophcf2|01508
ATGAGCGCCCCAAACAGAGTCTTGATCGCCGTCATCGGCGTCGGCGGCGTGGGCAAATGCTTCCTCTCTCAGCTG
CGATTGCTGGCCGCGCGCAGACCGTCACCGAAGCTCAGTCTTTGCTACATCTCGTCCAGTCGCAAGGCTCTGTAC
AATGATGATTACTCCGAGATCGCCGTCGAGGGCGTCATCGAGGCTCTGGCCGCGTCGAGAAAAGCCCCCCCTTCG
CTCCCCGAAGTCGTCGAGTATCTCGCTGCTGCTCCCGACAAGGTGATACTCGTCGACAACACCAGCTCGCAGCAT
GTTGCCGATGCGTACCCGCTCGCTCTCGGCCTGGGCGTCAACATCGTCACTCCCAATAAAAAGGCTTTCTCCGGT
CCCTACGAGCTCTGGCAGGACATCCTGGCCGCGTCGACCGCGTCTGGCGCCAAGTTCTACCACGAGTCGTCCGTC
GGTGCCGGCTTGCCCGTCATCTCGACGCTAAGGGACCTGATAGACACGGGCGACAAGGTGACCAAGATCGAGGGT
GTATTCAGCGGCACCATGTCTTTCCTCTTCAATTCCTTCGCCCCCACCGACGGGCAAGGCGGCGCCTGGTCAGCC
GAGGTCATCAAGGCCAAGGCGCTCGGCTACACCGAACCGGACCCGCGCGATGACCTCAACGGACTCGACGTCGCT
CGCAAGTTGACGATTCTGGCCCGCCTCGTCGGCCTCCCGATACAATCTCCGACGTCGTTTCCCGTCCAGAGTCTC
ATCCCGAAGGAGCTCGAGTCCTGTCAGAGCGGCGACGAGTTTCTCGAAAAGCTCGCCGCCTTTGATAGTCAGATG
GAGGTGACCAAGTCCGCGGCGGAGATGGAGGGCAAGGTGGTCCGGTTCGTGGGCAGCATCGATGTGGGCACCAAA
CAGGTCAAGGTTGGACTGGACATGTTTGAGCCGTCGCATCCGATTGCGGCGCTCAAGGGAAGCGACAACATCATA
AGCTTCTACACCGAGAGATACGGAAGCAATCCCCTGATTGTACAGGGTGCCGGGGCGGGGGGCGAGGTGACGGCA
ATGGGCGTGACGGCCGACATGCTCAAGGTGGTGGCGCAAATCTCATAG
Transcript >Ophcf2|01508
ATGAGCGCCCCAAACAGAGTCTTGATCGCCGTCATCGGCGTCGGCGGCGTGGGCAAATGCTTCCTCTCTCAGCTG
CGATTGCTGGCCGCGCGCAGACCGTCACCGAAGCTCAGTCTTTGCTACATCTCGTCCAGTCGCAAGGCTCTGTAC
AATGATGATTACTCCGAGATCGCCGTCGAGGGCGTCATCGAGGCTCTGGCCGCGTCGAGAAAAGCCCCCCCTTCG
CTCCCCGAAGTCGTCGAGTATCTCGCTGCTGCTCCCGACAAGGTGATACTCGTCGACAACACCAGCTCGCAGCAT
GTTGCCGATGCGTACCCGCTCGCTCTCGGCCTGGGCGTCAACATCGTCACTCCCAATAAAAAGGCTTTCTCCGGT
CCCTACGAGCTCTGGCAGGACATCCTGGCCGCGTCGACCGCGTCTGGCGCCAAGTTCTACCACGAGTCGTCCGTC
GGTGCCGGCTTGCCCGTCATCTCGACGCTAAGGGACCTGATAGACACGGGCGACAAGGTGACCAAGATCGAGGGT
GTATTCAGCGGCACCATGTCTTTCCTCTTCAATTCCTTCGCCCCCACCGACGGGCAAGGCGGCGCCTGGTCAGCC
GAGGTCATCAAGGCCAAGGCGCTCGGCTACACCGAACCGGACCCGCGCGATGACCTCAACGGACTCGACGTCGCT
CGCAAGTTGACGATTCTGGCCCGCCTCGTCGGCCTCCCGATACAATCTCCGACGTCGTTTCCCGTCCAGAGTCTC
ATCCCGAAGGAGCTCGAGTCCTGTCAGAGCGGCGACGAGTTTCTCGAAAAGCTCGCCGCCTTTGATAGTCAGATG
GAGGTGACCAAGTCCGCGGCGGAGATGGAGGGCAAGGTGGTCCGGTTCGTGGGCAGCATCGATGTGGGCACCAAA
CAGGTCAAGGTTGGACTGGACATGTTTGAGCCGTCGCATCCGATTGCGGCGCTCAAGGGAAGCGACAACATCATA
AGCTTCTACACCGAGAGATACGGAAGCAATCCCCTGATTGTACAGGGTGCCGGGGCGGGGGGCGAGGTGACGGCA
ATGGGCGTGACGGCCGACATGCTCAAGGTGGTGGCGCAAATCTCATAG
Gene >Ophcf2|01508
ATGAGCGCCCCAAACAGAGTCTTGATCGCCGTCATCGGTCGGTCCGCCCGCGTCTGTCTCGGGCCAAAGAGCCGC
CGCTGACCAGGAATTTCTTCGCTCTTCCCAGGCGTCGGCGGCGTGGGCAAATGCTTCCTCTCTCAGCTGCGATTG
CTGGCCGCGCGCAGACCGTCACCGAAGCTCAGTCTTTGCTACATCTCGTCCAGTCGCAAGGCTCTGTACAATGAT
GATTACTCCGAGATCGCCGTCGAGGGCGTCATCGAGGCTCTGGCCGCGTCGAGAAAAGCCCCCCCTTCGCTCCCC
GAAGTCGTCGAGTATCTCGCTGCTGCTCCCGACAAGGTGATACTCGTCGACAACACCAGCTCGCAGCATGTTGCC
GATGCGTACCCGCTCGCTCTCGGCCTGGGCGTCAACATCGTCACTCCCAATAAAAAGGCTTTCTCCGGTCCCTAC
GAGCTCTGGCAGGACATCCTGGCCGCGTCGACCGCGTCTGGCGCCAAGTTCTACCACGAGTCGTCCGTCGGTGCC
GGCTTGCCCGTCATCTCGACGCTAAGGGACCTGATAGACACGGGCGACAAGGTGACCAAGATCGAGGGTGTATTC
AGCGGCACCATGTCTTTCCTCTTCAATTCCTTCGCCCCCACCGACGGGCAAGGCGGCGCCTGGTCAGCCGAGGTC
ATCAAGGCCAAGGCGCTCGGCTACACCGAACCGGACCCGCGCGATGACCTCAACGGACTCGACGTCGCTCGCAAG
TTGACGATTCTGGCCCGCCTCGTCGGCCTCCCGATACAATCTCCGACGTCGTTTCCCGTCCAGAGTCTCATCCCG
AAGGAGCTCGAGTCCTGTCAGAGCGGCGACGAGTTTCTCGAAAAGCTCGCCGCCTTTGATAGTCAGATGGAGGTG
ACCAAGTCCGCGGCGGAGATGGAGGGCAAGGTGGTCCGGTTCGTGGGCAGCATCGATGTGGGCACCAAACAGGTC
AAGGTTGGACTGGACATGTTTGAGCCGTCGCATCCGATTGCGGCGCTCAAGGGAAGCGACAACATCATAAGCTTC
TACACCGAGAGATACGGAAGCAATCCCCTGATTGTACAGGGTGCCGGGGCGGGGGGCGAGGTGACGGCAATGGGC
GTGACGGCCGACATGCTCAAGGTGGTGGCGCAAATCTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail