Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01503
Gene name
Locationscaffold_01:5172383..5177826
Strand+
Gene length (bp)5443
Transcript length (bp)5148
Coding sequence length (bp)5148
Protein length (aa) 1716

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16213 DCB Dimerisation and cyclophilin-binding domain of Mon2 2.5E-45 4 175
PF12783 Sec7_N Guanine nucleotide exchange factor in Golgi transport N-terminal 3.1E-40 200 351
PF16206 Mon2_C C-terminal region of Mon2 protein 1.6E-19 1021 1243

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal|Nuclear export signal 0.4104 0.6328 0.0399 0.1019 0.0831 0.0328 0.2814 0.2287 0.5565 0.0191

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3205
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4028
Ophiocordyceps australis map64 (Brazil) OphauB2|904
Ophiocordyceps camponoti-floridani Ophcf2|01503 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3618
Ophiocordyceps kimflemingae Ophio5|1658
Ophiocordyceps subramaniannii Hirsu2|5767

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01503
MTTQLLTSELVNLVQESKRKHHELRQAADKSLEELKQLGSLSEQAAAEQLSRRSSFVNPFIIACGTKNAKFTGIA
IVCLQRLIIACALPPSKLTQVVEALMQASSAGLDVQLKILQALPSLLQNYAVHLQGDLLVTLLNVCFSLQSSKNA
IVNNTAAATLQQLVVAVFDKVVAEDKDASEGPVVGEAPSAAGPVELRAAALDAYRIFSDLCLMTENQRPEFLRSA
GLPQTFGLELIESVITNHGAIFAAHPEQAEILRMRVMPLVISALKGKPGFATCVRLVRILFTMLRRHVSILPKEC
GEALDILTQLLDQDSAPWKRALCMEVFRGIFAEHALVRRIYALYDAREGEKDMLKTLVATFVRLGTEKPVVIGLG
HQSTIPASDPANTTVAPSDQAMLEASGMAGIIGGGSLGSEGPSTGISVRSSSVRVSCIDQLDKTEPPAMPESYIY
SLVLTCVSSLSDGLAKFILPLTVPGDGRSRRRTLPKPDGRTDSPASTHSAADSPLSKSGARERSISSSFKKNPVP
LNPLEMEDHPMHAEVQICASIVEECWPAVLATCSTFLYASLDQEYYHGLVRAFQRFAHVAGLLHLSTPRDAFLTT
LGKSAVPPNVLSACYSPGLSRPAVSSPQGEVTANTLFNNARGLLGVEGTPTSSPLSGSERQRQASVESTAAVSLN
TRNLLCLRALLNLGIALGPTLGHAWTIVLETLQQADFVLFSTGKAPGRTPSIGNVRDSTGEAESATLMTNFGNEI
RSVEIAASRLAESTVDFPDASFIKVVEAMCMLVEAEPRDESRRSSTAELVTVEEQQQRSRPDRHRRMQSFSNQAS
SAPAQEYLFALNKLGEMATINLERLLGGDGEASGWHKITRQLISMLGSPTMAPPVRTKAAEVLSRLMLDAASAVA
VMSGEDQDARGATQLRVLGALRDALTPLLEHVSGLSVSNQVTDVAVHEIILEGLKSIIEGCGESLVCGWDTAFDI
IGSVFEPELPVAEEKREASPRAGILTTRSSKLVRSSFGSLQLICSDFLSSLPKACLLILVDTLYKFCSQDDDLNI
ALTTVTFYWVLSDFLSANEKSLVITADVLGESGSKDGLERLAADDEQKGSDAALWMLLLLRLTAVSTDERLELRN
SAIQTLLRIFDAYGDRLSAEAWSACVESVIFRLLSSLETELAGAQKADDVVEWQGTCVLVINGISDLLGNYLDVL
TTHDTFDRLWRDLLGHMTTLLDFRVLEVSTAVFKALTHILSRVHDGGKMPFDETSVEGVWQLWSRRIPTSKRAVE
NENNQSCLLAFVAALCEVYRLLQSELTVERVKRMLVLLQETVVEASEGSYVADVEHTTPLQTQVLAAVQMIRTDV
DGVPSEVVMQVSDFVTMAFTRAGRSPKRTYVAMSRASMTMLQALISRHASSEDMYTSGAVATALSALGKPIGLKY
RFPTVTKSEQPWRLATTAALEVLDATLPLLDSLAIPKETVGAIWAEAVSVAGGILGADTESIPAGSDLTDDEAFD
MASLSKLRGLLIPSLGGDAVGDGTRRAYAENLLRTSMVHPLTTDESWLVEGHDDRGAVYKPRPGRTATVAPTRRA
RVAYVALDELFSLVSIVSSVPEAEEGHRALRLRIASVAAPLLTLRCALTLRAYAADQPLRGKMPQPLSQRRELVW
ILRRLVALRSEGEALPGPGSTGGEDRKHLVRLYPLMVRSLAVDGDGEVQGLLREALEVGGGTVGR*
Coding >Ophcf2|01503
ATGACGACGCAGCTTTTGACCTCGGAACTGGTCAATCTCGTCCAGGAGAGCAAGAGAAAGCATCACGAGTTGCGC
CAGGCCGCCGATAAGTCTTTGGAGGAATTGAAGCAGCTTGGAAGCCTTTCGGAACAGGCCGCAGCAGAGCAGCTT
TCGCGCAGATCTTCCTTCGTCAATCCCTTCATCATCGCCTGTGGTACCAAAAATGCAAAGTTCACGGGCATCGCT
ATTGTCTGCCTGCAGCGGCTCATCATCGCCTGCGCTCTCCCGCCCTCCAAGTTGACTCAGGTCGTCGAGGCCTTG
ATGCAGGCATCTTCCGCCGGCTTGGACGTCCAGCTCAAGATTCTACAAGCGCTTCCATCCCTGCTGCAAAACTAT
GCCGTCCATCTTCAAGGTGACTTATTGGTGACGCTTCTCAACGTGTGTTTTTCCCTGCAGAGCAGCAAGAACGCC
ATCGTCAATAACACGGCGGCTGCAACTCTGCAACAACTGGTTGTCGCCGTCTTTGATAAGGTGGTGGCCGAGGAC
AAGGATGCATCCGAAGGGCCTGTCGTCGGCGAGGCTCCGTCCGCCGCCGGGCCGGTCGAGCTCCGTGCTGCGGCG
CTGGACGCGTACCGAATCTTTAGCGATCTATGCCTCATGACGGAGAACCAGCGTCCCGAGTTTCTACGTTCCGCA
GGTCTGCCGCAGACGTTTGGACTGGAGCTCATCGAGTCCGTCATCACCAACCATGGCGCCATCTTCGCCGCCCAT
CCCGAACAAGCTGAGATCCTCCGCATGCGGGTCATGCCCCTGGTCATCAGTGCCCTCAAGGGCAAGCCGGGCTTT
GCTACCTGCGTCCGGCTCGTTCGAATCCTTTTCACGATGCTTCGCCGCCATGTGAGCATCTTGCCGAAAGAGTGC
GGAGAAGCCCTTGACATCTTGACCCAGCTGCTAGACCAGGACTCCGCCCCGTGGAAGAGAGCACTCTGCATGGAG
GTGTTTCGGGGCATCTTTGCCGAACACGCCCTGGTCCGGCGCATCTATGCGCTTTATGACGCCAGGGAGGGAGAA
AAGGACATGCTCAAGACTCTGGTGGCGACGTTTGTTCGGTTGGGAACGGAGAAGCCAGTCGTGATAGGACTTGGT
CACCAATCGACGATTCCGGCATCGGATCCTGCCAATACGACCGTTGCGCCATCTGACCAGGCCATGTTGGAAGCC
AGCGGCATGGCCGGCATCATCGGAGGCGGCTCACTAGGATCTGAAGGGCCCAGCACCGGCATCAGTGTCCGGTCG
AGTTCCGTCCGCGTCTCTTGCATCGACCAGCTGGACAAGACGGAGCCGCCGGCGATGCCGGAGTCGTACATCTAC
AGCCTGGTCTTGACCTGCGTATCGTCTTTGTCTGACGGGCTGGCCAAGTTTATCCTCCCGCTGACTGTTCCCGGA
GACGGTCGCAGCCGGAGAAGAACACTCCCCAAGCCTGATGGTCGAACAGACTCGCCTGCCTCGACTCACTCTGCT
GCCGATAGTCCGCTTTCCAAGAGCGGCGCCCGAGAGAGGTCCATCTCTTCGTCGTTCAAGAAGAATCCCGTGCCC
CTGAATCCGTTGGAAATGGAGGACCACCCGATGCATGCCGAGGTTCAGATATGCGCCTCCATCGTCGAGGAGTGC
TGGCCGGCTGTGCTGGCCACTTGTTCGACATTCCTGTACGCCTCCCTGGATCAGGAATACTATCACGGTCTCGTG
AGAGCCTTTCAGAGGTTTGCCCACGTAGCGGGACTGCTGCACTTGTCGACTCCCCGAGACGCTTTCCTGACGACT
CTCGGCAAGTCTGCCGTTCCGCCCAACGTACTATCTGCATGCTACAGTCCAGGTCTTTCAAGGCCGGCGGTGTCG
AGCCCTCAAGGCGAGGTCACAGCCAACACGCTATTCAACAACGCGCGCGGTCTTCTCGGTGTCGAGGGCACGCCA
ACATCGTCTCCGTTATCGGGGAGCGAACGGCAGCGACAGGCATCCGTCGAATCGACGGCGGCAGTGAGCCTGAAT
ACACGAAACCTGCTCTGCCTGCGCGCTCTCTTGAATCTGGGGATCGCGTTGGGGCCCACGCTCGGTCATGCTTGG
ACAATCGTCTTGGAGACTCTACAGCAGGCCGACTTCGTGCTCTTCTCTACCGGCAAGGCTCCCGGCCGGACACCT
TCGATCGGAAATGTCCGGGACTCTACCGGCGAGGCGGAATCGGCGACGCTCATGACCAACTTTGGCAACGAGATC
CGCTCGGTCGAGATTGCGGCATCTAGGCTGGCCGAGAGCACGGTTGACTTTCCCGACGCGTCCTTCATCAAGGTC
GTCGAGGCCATGTGTATGCTGGTCGAGGCAGAGCCGAGGGATGAGTCTCGGAGGAGCAGCACGGCAGAACTCGTC
ACGGTCGAAGAGCAGCAGCAGCGGTCACGCCCGGACAGGCATCGGCGGATGCAAAGCTTCTCGAACCAGGCATCG
AGCGCACCGGCGCAGGAGTATCTCTTTGCCCTGAACAAGCTCGGTGAGATGGCCACCATCAATCTCGAAAGGTTG
CTGGGAGGCGATGGCGAAGCCTCGGGCTGGCACAAGATAACCAGGCAGCTCATCAGCATGCTGGGCTCGCCAACC
ATGGCTCCGCCGGTCAGAACCAAGGCGGCCGAGGTTCTCTCGAGGCTCATGCTGGACGCCGCCAGCGCCGTAGCC
GTCATGTCCGGCGAGGACCAAGACGCCAGGGGCGCGACCCAGCTCCGGGTATTGGGGGCTTTGAGGGATGCCCTG
ACGCCTCTGCTGGAGCACGTCAGCGGCTTATCGGTCTCGAACCAGGTAACGGACGTGGCCGTTCACGAAATCATC
CTCGAGGGTTTAAAGAGCATCATCGAGGGCTGCGGGGAGAGCCTCGTCTGTGGCTGGGACACGGCCTTTGACATC
ATCGGAAGCGTCTTCGAGCCGGAGCTTCCAGTGGCCGAGGAGAAGCGCGAGGCGTCTCCTCGCGCCGGGATTCTG
ACGACTCGCTCATCTAAGCTCGTGCGCTCGTCGTTTGGTTCGCTCCAACTCATCTGCTCCGACTTCTTGTCGTCT
CTGCCCAAGGCCTGTCTTCTCATTCTGGTGGATACGCTTTACAAGTTTTGCTCGCAGGACGATGACCTGAACATT
GCGCTTACGACCGTCACCTTCTACTGGGTTCTATCGGATTTTCTGTCCGCCAACGAGAAGTCTCTCGTCATCACG
GCAGATGTTCTCGGCGAGAGCGGCAGCAAAGATGGACTGGAAAGGCTGGCGGCCGACGACGAACAGAAGGGATCG
GACGCCGCGCTATGGATGCTGCTTCTACTGCGCCTGACAGCCGTATCGACGGACGAGAGACTGGAGCTTCGCAAC
AGCGCAATCCAGACGCTTCTCCGCATCTTTGACGCCTATGGTGACCGTCTCAGCGCCGAGGCTTGGTCTGCGTGT
GTCGAGTCGGTCATATTCAGGCTTCTATCTTCTCTCGAGACCGAGCTCGCAGGCGCACAAAAGGCTGACGATGTC
GTCGAGTGGCAAGGCACGTGCGTGCTCGTCATCAACGGCATCTCAGACCTTCTCGGCAACTACCTCGACGTTCTC
ACGACGCACGACACCTTTGACCGGCTCTGGCGCGATCTTCTGGGGCACATGACGACTCTGCTGGATTTCCGAGTG
CTCGAGGTCAGCACCGCCGTGTTCAAGGCCTTGACTCACATCCTGTCTCGGGTCCACGATGGGGGCAAGATGCCC
TTTGACGAGACGTCGGTCGAGGGCGTGTGGCAGCTCTGGTCGCGCAGGATCCCGACGTCGAAGCGGGCTGTCGAG
AACGAGAACAACCAGAGCTGTCTGTTGGCATTTGTGGCGGCCCTTTGCGAGGTATACAGGCTGCTGCAGAGCGAG
CTGACGGTCGAGAGGGTCAAGCGGATGCTCGTGCTGTTGCAAGAGACGGTGGTGGAGGCGTCCGAGGGCAGCTAC
GTGGCCGACGTCGAGCATACGACGCCTCTACAGACGCAGGTCCTGGCAGCCGTGCAGATGATCCGGACCGACGTC
GACGGCGTACCGTCGGAGGTGGTGATGCAGGTGTCGGACTTTGTGACGATGGCGTTTACACGAGCCGGGCGAAGT
CCGAAGCGAACCTACGTGGCCATGTCCAGGGCCAGCATGACGATGCTACAGGCTCTCATCTCCAGGCACGCCTCG
AGCGAGGACATGTACACGAGCGGTGCGGTGGCGACGGCGCTGTCGGCTCTAGGCAAGCCCATCGGGCTCAAGTAC
CGCTTCCCGACGGTGACCAAGTCGGAGCAGCCATGGAGACTGGCGACGACGGCGGCCCTGGAGGTGCTGGATGCC
ACGCTCCCGCTTCTGGACTCGCTCGCCATTCCCAAGGAGACGGTCGGGGCCATCTGGGCCGAGGCCGTGTCGGTG
GCCGGAGGTATCCTCGGCGCGGATACGGAAAGCATCCCGGCCGGATCGGACTTGACCGACGACGAGGCGTTTGAC
ATGGCGTCGCTGAGCAAGCTGCGAGGGCTCCTCATTCCCTCGCTGGGAGGCGACGCGGTAGGAGACGGGACACGC
CGGGCCTACGCCGAGAACCTGTTGCGGACATCCATGGTCCATCCGCTCACAACGGACGAGTCCTGGCTGGTGGAG
GGACACGACGACCGAGGCGCCGTTTACAAGCCGCGTCCGGGCCGGACAGCGACGGTGGCCCCGACGAGACGAGCG
AGGGTGGCCTACGTCGCCCTAGACGAGCTCTTCTCACTCGTATCCATCGTCAGCTCAGTTCCGGAAGCCGAGGAG
GGACATCGCGCTCTCCGTCTCCGCATCGCCAGCGTAGCAGCACCGCTCCTCACGCTCCGATGCGCCCTGACGTTA
CGGGCCTACGCGGCCGACCAGCCGCTACGGGGCAAGATGCCGCAGCCACTGAGCCAGCGTCGAGAGCTGGTCTGG
ATCCTGAGGAGGCTGGTGGCTCTGCGCAGCGAGGGAGAGGCCCTTCCGGGTCCGGGCTCGACGGGCGGCGAGGAC
CGGAAGCATCTCGTCCGTCTTTACCCTCTGATGGTCAGGTCGTTGGCGGTGGATGGCGATGGGGAGGTGCAGGGG
CTGCTGCGGGAGGCGTTGGAAGTGGGAGGGGGAACCGTGGGTAGGTAG
Transcript >Ophcf2|01503
ATGACGACGCAGCTTTTGACCTCGGAACTGGTCAATCTCGTCCAGGAGAGCAAGAGAAAGCATCACGAGTTGCGC
CAGGCCGCCGATAAGTCTTTGGAGGAATTGAAGCAGCTTGGAAGCCTTTCGGAACAGGCCGCAGCAGAGCAGCTT
TCGCGCAGATCTTCCTTCGTCAATCCCTTCATCATCGCCTGTGGTACCAAAAATGCAAAGTTCACGGGCATCGCT
ATTGTCTGCCTGCAGCGGCTCATCATCGCCTGCGCTCTCCCGCCCTCCAAGTTGACTCAGGTCGTCGAGGCCTTG
ATGCAGGCATCTTCCGCCGGCTTGGACGTCCAGCTCAAGATTCTACAAGCGCTTCCATCCCTGCTGCAAAACTAT
GCCGTCCATCTTCAAGGTGACTTATTGGTGACGCTTCTCAACGTGTGTTTTTCCCTGCAGAGCAGCAAGAACGCC
ATCGTCAATAACACGGCGGCTGCAACTCTGCAACAACTGGTTGTCGCCGTCTTTGATAAGGTGGTGGCCGAGGAC
AAGGATGCATCCGAAGGGCCTGTCGTCGGCGAGGCTCCGTCCGCCGCCGGGCCGGTCGAGCTCCGTGCTGCGGCG
CTGGACGCGTACCGAATCTTTAGCGATCTATGCCTCATGACGGAGAACCAGCGTCCCGAGTTTCTACGTTCCGCA
GGTCTGCCGCAGACGTTTGGACTGGAGCTCATCGAGTCCGTCATCACCAACCATGGCGCCATCTTCGCCGCCCAT
CCCGAACAAGCTGAGATCCTCCGCATGCGGGTCATGCCCCTGGTCATCAGTGCCCTCAAGGGCAAGCCGGGCTTT
GCTACCTGCGTCCGGCTCGTTCGAATCCTTTTCACGATGCTTCGCCGCCATGTGAGCATCTTGCCGAAAGAGTGC
GGAGAAGCCCTTGACATCTTGACCCAGCTGCTAGACCAGGACTCCGCCCCGTGGAAGAGAGCACTCTGCATGGAG
GTGTTTCGGGGCATCTTTGCCGAACACGCCCTGGTCCGGCGCATCTATGCGCTTTATGACGCCAGGGAGGGAGAA
AAGGACATGCTCAAGACTCTGGTGGCGACGTTTGTTCGGTTGGGAACGGAGAAGCCAGTCGTGATAGGACTTGGT
CACCAATCGACGATTCCGGCATCGGATCCTGCCAATACGACCGTTGCGCCATCTGACCAGGCCATGTTGGAAGCC
AGCGGCATGGCCGGCATCATCGGAGGCGGCTCACTAGGATCTGAAGGGCCCAGCACCGGCATCAGTGTCCGGTCG
AGTTCCGTCCGCGTCTCTTGCATCGACCAGCTGGACAAGACGGAGCCGCCGGCGATGCCGGAGTCGTACATCTAC
AGCCTGGTCTTGACCTGCGTATCGTCTTTGTCTGACGGGCTGGCCAAGTTTATCCTCCCGCTGACTGTTCCCGGA
GACGGTCGCAGCCGGAGAAGAACACTCCCCAAGCCTGATGGTCGAACAGACTCGCCTGCCTCGACTCACTCTGCT
GCCGATAGTCCGCTTTCCAAGAGCGGCGCCCGAGAGAGGTCCATCTCTTCGTCGTTCAAGAAGAATCCCGTGCCC
CTGAATCCGTTGGAAATGGAGGACCACCCGATGCATGCCGAGGTTCAGATATGCGCCTCCATCGTCGAGGAGTGC
TGGCCGGCTGTGCTGGCCACTTGTTCGACATTCCTGTACGCCTCCCTGGATCAGGAATACTATCACGGTCTCGTG
AGAGCCTTTCAGAGGTTTGCCCACGTAGCGGGACTGCTGCACTTGTCGACTCCCCGAGACGCTTTCCTGACGACT
CTCGGCAAGTCTGCCGTTCCGCCCAACGTACTATCTGCATGCTACAGTCCAGGTCTTTCAAGGCCGGCGGTGTCG
AGCCCTCAAGGCGAGGTCACAGCCAACACGCTATTCAACAACGCGCGCGGTCTTCTCGGTGTCGAGGGCACGCCA
ACATCGTCTCCGTTATCGGGGAGCGAACGGCAGCGACAGGCATCCGTCGAATCGACGGCGGCAGTGAGCCTGAAT
ACACGAAACCTGCTCTGCCTGCGCGCTCTCTTGAATCTGGGGATCGCGTTGGGGCCCACGCTCGGTCATGCTTGG
ACAATCGTCTTGGAGACTCTACAGCAGGCCGACTTCGTGCTCTTCTCTACCGGCAAGGCTCCCGGCCGGACACCT
TCGATCGGAAATGTCCGGGACTCTACCGGCGAGGCGGAATCGGCGACGCTCATGACCAACTTTGGCAACGAGATC
CGCTCGGTCGAGATTGCGGCATCTAGGCTGGCCGAGAGCACGGTTGACTTTCCCGACGCGTCCTTCATCAAGGTC
GTCGAGGCCATGTGTATGCTGGTCGAGGCAGAGCCGAGGGATGAGTCTCGGAGGAGCAGCACGGCAGAACTCGTC
ACGGTCGAAGAGCAGCAGCAGCGGTCACGCCCGGACAGGCATCGGCGGATGCAAAGCTTCTCGAACCAGGCATCG
AGCGCACCGGCGCAGGAGTATCTCTTTGCCCTGAACAAGCTCGGTGAGATGGCCACCATCAATCTCGAAAGGTTG
CTGGGAGGCGATGGCGAAGCCTCGGGCTGGCACAAGATAACCAGGCAGCTCATCAGCATGCTGGGCTCGCCAACC
ATGGCTCCGCCGGTCAGAACCAAGGCGGCCGAGGTTCTCTCGAGGCTCATGCTGGACGCCGCCAGCGCCGTAGCC
GTCATGTCCGGCGAGGACCAAGACGCCAGGGGCGCGACCCAGCTCCGGGTATTGGGGGCTTTGAGGGATGCCCTG
ACGCCTCTGCTGGAGCACGTCAGCGGCTTATCGGTCTCGAACCAGGTAACGGACGTGGCCGTTCACGAAATCATC
CTCGAGGGTTTAAAGAGCATCATCGAGGGCTGCGGGGAGAGCCTCGTCTGTGGCTGGGACACGGCCTTTGACATC
ATCGGAAGCGTCTTCGAGCCGGAGCTTCCAGTGGCCGAGGAGAAGCGCGAGGCGTCTCCTCGCGCCGGGATTCTG
ACGACTCGCTCATCTAAGCTCGTGCGCTCGTCGTTTGGTTCGCTCCAACTCATCTGCTCCGACTTCTTGTCGTCT
CTGCCCAAGGCCTGTCTTCTCATTCTGGTGGATACGCTTTACAAGTTTTGCTCGCAGGACGATGACCTGAACATT
GCGCTTACGACCGTCACCTTCTACTGGGTTCTATCGGATTTTCTGTCCGCCAACGAGAAGTCTCTCGTCATCACG
GCAGATGTTCTCGGCGAGAGCGGCAGCAAAGATGGACTGGAAAGGCTGGCGGCCGACGACGAACAGAAGGGATCG
GACGCCGCGCTATGGATGCTGCTTCTACTGCGCCTGACAGCCGTATCGACGGACGAGAGACTGGAGCTTCGCAAC
AGCGCAATCCAGACGCTTCTCCGCATCTTTGACGCCTATGGTGACCGTCTCAGCGCCGAGGCTTGGTCTGCGTGT
GTCGAGTCGGTCATATTCAGGCTTCTATCTTCTCTCGAGACCGAGCTCGCAGGCGCACAAAAGGCTGACGATGTC
GTCGAGTGGCAAGGCACGTGCGTGCTCGTCATCAACGGCATCTCAGACCTTCTCGGCAACTACCTCGACGTTCTC
ACGACGCACGACACCTTTGACCGGCTCTGGCGCGATCTTCTGGGGCACATGACGACTCTGCTGGATTTCCGAGTG
CTCGAGGTCAGCACCGCCGTGTTCAAGGCCTTGACTCACATCCTGTCTCGGGTCCACGATGGGGGCAAGATGCCC
TTTGACGAGACGTCGGTCGAGGGCGTGTGGCAGCTCTGGTCGCGCAGGATCCCGACGTCGAAGCGGGCTGTCGAG
AACGAGAACAACCAGAGCTGTCTGTTGGCATTTGTGGCGGCCCTTTGCGAGGTATACAGGCTGCTGCAGAGCGAG
CTGACGGTCGAGAGGGTCAAGCGGATGCTCGTGCTGTTGCAAGAGACGGTGGTGGAGGCGTCCGAGGGCAGCTAC
GTGGCCGACGTCGAGCATACGACGCCTCTACAGACGCAGGTCCTGGCAGCCGTGCAGATGATCCGGACCGACGTC
GACGGCGTACCGTCGGAGGTGGTGATGCAGGTGTCGGACTTTGTGACGATGGCGTTTACACGAGCCGGGCGAAGT
CCGAAGCGAACCTACGTGGCCATGTCCAGGGCCAGCATGACGATGCTACAGGCTCTCATCTCCAGGCACGCCTCG
AGCGAGGACATGTACACGAGCGGTGCGGTGGCGACGGCGCTGTCGGCTCTAGGCAAGCCCATCGGGCTCAAGTAC
CGCTTCCCGACGGTGACCAAGTCGGAGCAGCCATGGAGACTGGCGACGACGGCGGCCCTGGAGGTGCTGGATGCC
ACGCTCCCGCTTCTGGACTCGCTCGCCATTCCCAAGGAGACGGTCGGGGCCATCTGGGCCGAGGCCGTGTCGGTG
GCCGGAGGTATCCTCGGCGCGGATACGGAAAGCATCCCGGCCGGATCGGACTTGACCGACGACGAGGCGTTTGAC
ATGGCGTCGCTGAGCAAGCTGCGAGGGCTCCTCATTCCCTCGCTGGGAGGCGACGCGGTAGGAGACGGGACACGC
CGGGCCTACGCCGAGAACCTGTTGCGGACATCCATGGTCCATCCGCTCACAACGGACGAGTCCTGGCTGGTGGAG
GGACACGACGACCGAGGCGCCGTTTACAAGCCGCGTCCGGGCCGGACAGCGACGGTGGCCCCGACGAGACGAGCG
AGGGTGGCCTACGTCGCCCTAGACGAGCTCTTCTCACTCGTATCCATCGTCAGCTCAGTTCCGGAAGCCGAGGAG
GGACATCGCGCTCTCCGTCTCCGCATCGCCAGCGTAGCAGCACCGCTCCTCACGCTCCGATGCGCCCTGACGTTA
CGGGCCTACGCGGCCGACCAGCCGCTACGGGGCAAGATGCCGCAGCCACTGAGCCAGCGTCGAGAGCTGGTCTGG
ATCCTGAGGAGGCTGGTGGCTCTGCGCAGCGAGGGAGAGGCCCTTCCGGGTCCGGGCTCGACGGGCGGCGAGGAC
CGGAAGCATCTCGTCCGTCTTTACCCTCTGATGGTCAGGTCGTTGGCGGTGGATGGCGATGGGGAGGTGCAGGGG
CTGCTGCGGGAGGCGTTGGAAGTGGGAGGGGGAACCGTGGGTAGGTAG
Gene >Ophcf2|01503
ATGACGACGCAGCTTTTGACCTCGGAACTGGTCAATCTCGTCCAGGAGAGCAAGAGAAAGCATCACGAGTTGCGC
CAGGTACGGTTTGCCCCTGTCGCACCTCGCTTGCGCCCTGACTCACCATTATCCTTCTCTCCAGGCCGCCGATAA
GTCTTTGGAGGAATTGAAGCAGCTTGGAAGCCTTTCGGAACAGGCCGCAGCAGAGCGTGCGTTCATCAGACCCTG
ACTTGTCACCTCCTTGTTCTCGTCTGACGTCGTCTCTCCGCAAAGAGCTTTCGCGCAGATCTTCCTTCGTCAATC
CCTTCATCATCGCCTGTGGTACCAAAAATGCAAAGTTCACGGGCATCGCTATTGTCTGCCTGCAGCGGCTCATCA
TCGCCTGCGCTCTCCCGCCCTCCAAGTTGACTCAGGTCGTCGAGGCCTTGATGCAGGCATCTTCCGCCGGCTTGG
ACGTCCAGCTCAAGATTCTACAAGCGCTTCCATCCCTGCTGCAAAACTATGCCGTCCATCTTCAAGGTGACTTAT
TGGTGACGCTTCTCAACGTGTGTTTTTCCCTGCAGAGCAGCAAGAACGCCATCGTCAATAACACGGCGGCTGCAA
CTCTGCAACAACTGGTTGTCGCCGTCTTTGATAAGGTGGTGGCCGAGGACAGTAGGTGTCTCAGCGGCCGGAGTC
TACCAAGACGGGTTCGGGGCCGTCTGCTGACGAGCCATAGAGGATGCATCCGAAGGGCCTGTCGTCGGCGAGGCT
CCGTCCGCCGCCGGGCCGGTCGAGCTCCGTGCTGCGGCGCTGGACGCGTACCGAGTGAGCGACACCATTGTTGGG
CTTCATACGGGATGCTAAAGCTATGAGCAGATCTTTAGCGATCTATGCCTCATGACGGAGAACCAGCGTCCCGAG
TTTCTACGTTCCGCAGGTCTGCCGCAGACGTTTGGACTGGAGCTCATCGAGTCCGTCATCACCAACCATGGCGCC
ATCTTCGCCGCCCATCCCGAACAAGCTGAGATCCTCCGCATGCGGGTCATGCCCCTGGTCATCAGTGCCCTCAAG
GGCAAGCCGGGCTTTGCTACCTGCGTCCGGCTCGTTCGAATCCTTTTCACGATGCTTCGCCGCCATGTGAGCATC
TTGCCGAAAGAGTGCGGAGAAGCCCTTGACATCTTGACCCAGCTGCTAGACCAGGACTCCGCCCCGTGGAAGAGA
GCACTCTGCATGGAGGTGTTTCGGGGCATCTTTGCCGAACACGCCCTGGTCCGGCGCATCTATGCGCTTTATGAC
GCCAGGGAGGGAGAAAAGGACATGCTCAAGACTCTGGTGGCGACGTTTGTTCGGTTGGGAACGGAGAAGCCAGTC
GTGATAGGACTTGGTCACCAATCGACGATTCCGGCATCGGATCCTGCCAATACGACCGTTGCGCCATCTGACCAG
GCCATGTTGGAAGCCAGCGGCATGGCCGGCATCATCGGAGGCGGCTCACTAGGATCTGAAGGGCCCAGCACCGGC
ATCAGTGTCCGGTCGAGTTCCGTCCGCGTCTCTTGCATCGACCAGCTGGACAAGACGGAGCCGCCGGCGATGCCG
GAGTCGTACATCTACAGCCTGGTCTTGACCTGCGTATCGTCTTTGTCTGACGGGCTGGCCAAGTTTATCCTCCCG
CTGACTGTTCCCGGAGACGGTCGCAGCCGGAGAAGAACACTCCCCAAGCCTGATGGTCGAACAGACTCGCCTGCC
TCGACTCACTCTGCTGCCGATAGTCCGCTTTCCAAGAGCGGCGCCCGAGAGAGGTCCATCTCTTCGTCGTTCAAG
AAGAATCCCGTGCCCCTGAATCCGTTGGAAATGGAGGACCACCCGATGCATGCCGAGGTTCAGATATGCGCCTCC
ATCGTCGAGGAGTGCTGGCCGGCTGTGCTGGCCACTTGTTCGACATTCCTGTACGCCTCCCTGGATCAGGAATAC
TATCACGGTCTCGTGAGAGCCTTTCAGAGGTTTGCCCACGTAGCGGGACTGCTGCACTTGTCGACTCCCCGAGAC
GCTTTCCTGACGACTCTCGGCAAGTCTGCCGTTCCGCCCAACGTACTATCTGCATGCTACAGTCCAGGTCTTTCA
AGGCCGGCGGTGTCGAGCCCTCAAGGCGAGGTCACAGCCAACACGCTATTCAACAACGCGCGCGGTCTTCTCGGT
GTCGAGGGCACGCCAACATCGTCTCCGTTATCGGGGAGCGAACGGCAGCGACAGGCATCCGTCGAATCGACGGCG
GCAGTGAGCCTGAATACACGAAACCTGCTCTGCCTGCGCGCTCTCTTGAATCTGGGGATCGCGTTGGGGCCCACG
CTCGGTCATGCTTGGACAATCGTCTTGGAGACTCTACAGCAGGCCGACTTCGTGCTCTTCTCTACCGGCAAGGCT
CCCGGCCGGACACCTTCGATCGGAAATGTCCGGGACTCTACCGGCGAGGCGGAATCGGCGACGCTCATGACCAAC
TTTGGCAACGAGATCCGCTCGGTCGAGATTGCGGCATCTAGGCTGGCCGAGAGCACGGTTGACTTTCCCGACGCG
TCCTTCATCAAGGTCGTCGAGGCCATGTGTATGCTGGTCGAGGCAGAGCCGAGGGATGAGTCTCGGAGGAGCAGC
ACGGCAGAACTCGTCACGGTCGAAGAGCAGCAGCAGCGGTCACGCCCGGACAGGCATCGGCGGATGCAAAGCTTC
TCGAACCAGGCATCGAGCGCACCGGCGCAGGAGTATCTCTTTGCCCTGAACAAGCTCGGTGAGATGGCCACCATC
AATCTCGAAAGGTTGCTGGGAGGCGATGGCGAAGCCTCGGGCTGGCACAAGATAACCAGGCAGCTCATCAGCATG
CTGGGCTCGCCAACCATGGCTCCGCCGGTCAGAACCAAGGCGGCCGAGGTTCTCTCGAGGCTCATGCTGGACGCC
GCCAGCGCCGTAGCCGTCATGTCCGGCGAGGACCAAGACGCCAGGGGCGCGACCCAGCTCCGGGTATTGGGGGCT
TTGAGGGATGCCCTGACGCCTCTGCTGGAGCACGTCAGCGGCTTATCGGTCTCGAACCAGGTAACGGACGTGGCC
GTTCACGAAATCATCCTCGAGGGTTTAAAGAGCATCATCGAGGGCTGCGGGGAGAGCCTCGTCTGTGGCTGGGAC
ACGGCCTTTGACATCATCGGAAGCGTCTTCGAGCCGGAGCTTCCAGTGGCCGAGGAGAAGCGCGAGGCGTCTCCT
CGCGCCGGGATTCTGACGACTCGCTCATCTAAGCTCGTGCGCTCGTCGTTTGGTTCGCTCCAACTCATCTGCTCC
GACTTCTTGTCGTCTCTGCCCAAGGCCTGTCTTCTCATTCTGGTGGATACGCTTTACAAGTTTTGCTCGCAGGAC
GATGACCTGAACATTGCGCTTACGGTATGTCCCGTAACTCACCCCTGAAGCTGGCTTCACTGACCAGTCCGGACT
ACAGACCGTCACCTTCTACTGGGTTCTATCGGATTTTCTGTCCGCCAACGAGAAGTCTCTCGTCATCACGGCAGA
TGTTCTCGGCGAGAGCGGCAGCAAAGATGGACTGGAAAGGCTGGCGGCCGACGACGAACAGAAGGGATCGGACGC
CGCGCTATGGATGCTGCTTCTACTGCGCCTGACAGCCGTATCGACGGACGAGAGACTGGAGCTTCGCAACAGCGC
AATCCAGACGCTTCTCCGCATCTTTGACGCCTATGGTGACCGTCTCAGCGCCGAGGCTTGGTCTGCGTGTGTCGA
GTCGGTCATATTCAGGCTTCTATCTTCTCTCGAGACCGAGCTCGCAGGCGCACAAAAGGCTGACGATGTCGTCGA
GTGGCAAGGCACGTGCGTGCTCGTCATCAACGGCATCTCAGACCTTCTCGGCAACTACCTCGACGTTCTCACGAC
GCACGACACCTTTGACCGGCTCTGGCGCGATCTTCTGGGGCACATGACGACTCTGCTGGATTTCCGAGTGCTCGA
GGTCAGCACCGCCGTGTTCAAGGCCTTGACTCACATCCTGTCTCGGGTCCACGATGGGGGCAAGATGCCCTTTGA
CGAGACGTCGGTCGAGGGCGTGTGGCAGCTCTGGTCGCGCAGGATCCCGACGTCGAAGCGGGCTGTCGAGAACGA
GAACAACCAGAGCTGTCTGTTGGCATTTGTGGCGGCCCTTTGCGAGGTATACAGGCTGCTGCAGAGCGAGCTGAC
GGTCGAGAGGGTCAAGCGGATGCTCGTGCTGTTGCAAGAGACGGTGGTGGAGGCGTCCGAGGGCAGCTACGTGGC
CGACGTCGAGCATACGACGCCTCTACAGACGCAGGTCCTGGCAGCCGTGCAGATGATCCGGACCGACGTCGACGG
CGTACCGTCGGAGGTGGTGATGCAGGTGTCGGACTTTGTGACGATGGCGTTTACACGAGCCGGGCGAAGTCCGAA
GCGAACCTACGTGGCCATGTCCAGGGCCAGCATGACGATGCTACAGGCTCTCATCTCCAGGCACGCCTCGAGCGA
GGACATGTACACGAGCGGTGCGGTGGCGACGGCGCTGTCGGCTCTAGGCAAGCCCATCGGGCTCAAGTACCGCTT
CCCGACGGTGACCAAGTCGGAGCAGCCATGGAGACTGGCGACGACGGCGGCCCTGGAGGTGCTGGATGCCACGCT
CCCGCTTCTGGACTCGCTCGCCATTCCCAAGGAGACGGTCGGGGCCATCTGGGCCGAGGCCGTGTCGGTGGCCGG
AGGTATCCTCGGCGCGGATACGGAAAGCATCCCGGCCGGATCGGACTTGACCGACGACGAGGCGTTTGACATGGC
GTCGCTGAGCAAGCTGCGAGGGCTCCTCATTCCCTCGCTGGGAGGCGACGCGGTAGGAGACGGGACACGCCGGGC
CTACGCCGAGAACCTGTTGCGGACATCCATGGTCCATCCGCTCACAACGGACGAGTCCTGGCTGGTGGAGGGACA
CGACGACCGAGGCGCCGTTTACAAGCCGCGTCCGGGCCGGACAGCGACGGTGGCCCCGACGAGACGAGCGAGGGT
GGCCTACGTCGCCCTAGACGAGCTCTTCTCACTCGTATCCATCGTCAGCTCAGTTCCGGAAGCCGAGGAGGGACA
TCGCGCTCTCCGTCTCCGCATCGCCAGCGTAGCAGCACCGCTCCTCACGCTCCGATGCGCCCTGACGTTACGGGC
CTACGCGGCCGACCAGCCGCTACGGGGCAAGATGCCGCAGCCACTGAGCCAGCGTCGAGAGCTGGTCTGGATCCT
GAGGAGGCTGGTGGCTCTGCGCAGCGAGGGAGAGGCCCTTCCGGGTCCGGGCTCGACGGGCGGCGAGGACCGGAA
GCATCTCGTCCGTCTTTACCCTCTGATGGTCAGGTCGTTGGCGGTGGATGGCGATGGGGAGGTGCAGGGGCTGCT
GCGGGAGGCGTTGGAAGTGGGAGGGGGAACCGTGGGTAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail