Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01497
Gene name
Locationscaffold_01:5159642..5161053
Strand-
Gene length (bp)1411
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain 8.4E-49 243 409
PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain 5.3E-24 118 239

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0008237 metallopeptidase activity No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6324 0.2941 0.5703 0.2361 0.2604 0.1739 0.1461 0.0218 0.0509 0.109

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.00 0.01 1.98
Alive In ants, during behavior modification 4.88 0.85 8.91
Dead In ants, recently dead 4.25 1.01 7.50

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.705324 no
Dead Fungus 0.001409 yes

Orthologs

Orthofinder run ID4
Orthogroup4021
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6008
Ophiocordyceps australis map64 (Brazil) OphauB2|1813
Ophiocordyceps camponoti-floridani Ophcf2|01497 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3624
Ophiocordyceps kimflemingae Ophio5|1664
Ophiocordyceps subramaniannii Hirsu2|8082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01497
MPCPCFIVPPHLLRSIAESTSNPQHVRQAAQASLVSTDRVKVGRQDLMSQLADPTARRDCRPAPFIPEAVLARLS
ASEGVDEHVREQAKRDLDHLQAFIAKPLAEQQASLAAAEDDKKKHKGNPYRAVYDAKKTMDQSDLPGELERAEGE
GKVKDEDVNFAYDNVGLVVDFYKKQFQWKSIDNKNADIISSVHFGKQFENAFWDPEQRQMVFGDGGEFLGHFTSC
IDVIGHELTHAITEHTSPLQYSGQPGALNEHISDVFGIMVKQSAEKEKADEADWLVGEGCLLPGVKGTALRSMKN
PGTAYNDPRLGKDPQVDNMSEYETTFEDNGGVHIYSGIPNKAFYLAAVAFGGYSWEKAGQIWWKAMTSGRVPSRC
TFQQFADVTVECATDEFGEEAGKKVRKAWDKVGVTRKV*
Coding >Ophcf2|01497
ATGCCTTGCCCCTGCTTCATCGTTCCGCCTCACCTCCTCCGCAGCATCGCCGAGTCGACCAGCAACCCTCAGCAT
GTCCGTCAAGCTGCTCAGGCCTCGCTCGTCTCTACGGATCGAGTCAAAGTCGGTCGGCAGGATCTCATGTCCCAG
CTGGCGGATCCCACGGCCCGGCGCGATTGCCGACCTGCTCCCTTTATCCCCGAGGCGGTCCTCGCCAGACTCTCA
GCTTCCGAGGGTGTAGACGAACATGTTCGCGAGCAGGCCAAGAGAGACTTGGACCATCTTCAGGCCTTTATTGCC
AAGCCTCTGGCTGAGCAGCAGGCCAGCTTGGCCGCCGCCGAGGACGACAAGAAGAAGCACAAGGGCAACCCCTAT
CGTGCCGTGTACGACGCAAAGAAGACGATGGACCAGTCGGATCTGCCTGGCGAATTGGAGCGGGCCGAAGGCGAA
GGCAAGGTCAAGGACGAAGACGTCAACTTTGCTTACGACAATGTCGGCCTCGTCGTCGACTTTTACAAGAAGCAA
TTCCAGTGGAAGTCGATTGACAACAAGAACGCCGATATCATTAGCTCCGTTCACTTTGGAAAGCAATTTGAAAAT
GCTTTCTGGGACCCCGAGCAGAGGCAGATGGTGTTTGGCGACGGAGGCGAGTTTCTCGGCCACTTCACCAGCTGC
ATCGACGTCATCGGCCACGAGCTCACTCACGCCATCACGGAGCACACCAGTCCCCTCCAGTACTCGGGTCAGCCG
GGCGCGCTCAACGAGCACATCTCGGACGTCTTTGGCATCATGGTCAAGCAGTCGGCCGAGAAGGAAAAAGCGGAC
GAGGCGGACTGGCTCGTGGGTGAAGGATGTTTGCTGCCCGGCGTCAAGGGGACGGCATTGCGAAGCATGAAGAAT
CCCGGGACGGCTTACAACGACCCTCGTTTGGGTAAAGACCCGCAGGTTGACAACATGAGCGAGTACGAGACGACG
TTTGAGGACAATGGAGGCGTGCACATCTACTCGGGCATCCCCAACAAGGCGTTTTACCTGGCGGCCGTGGCCTTT
GGCGGCTACTCTTGGGAGAAGGCGGGCCAGATCTGGTGGAAGGCCATGACGAGCGGACGGGTGCCTTCGCGGTGC
ACCTTTCAGCAGTTTGCCGACGTGACGGTGGAGTGTGCGACGGACGAGTTTGGCGAGGAGGCGGGAAAGAAGGTG
CGCAAGGCGTGGGACAAGGTGGGCGTGACGCGCAAGGTCTAG
Transcript >Ophcf2|01497
ATGCCTTGCCCCTGCTTCATCGTTCCGCCTCACCTCCTCCGCAGCATCGCCGAGTCGACCAGCAACCCTCAGCAT
GTCCGTCAAGCTGCTCAGGCCTCGCTCGTCTCTACGGATCGAGTCAAAGTCGGTCGGCAGGATCTCATGTCCCAG
CTGGCGGATCCCACGGCCCGGCGCGATTGCCGACCTGCTCCCTTTATCCCCGAGGCGGTCCTCGCCAGACTCTCA
GCTTCCGAGGGTGTAGACGAACATGTTCGCGAGCAGGCCAAGAGAGACTTGGACCATCTTCAGGCCTTTATTGCC
AAGCCTCTGGCTGAGCAGCAGGCCAGCTTGGCCGCCGCCGAGGACGACAAGAAGAAGCACAAGGGCAACCCCTAT
CGTGCCGTGTACGACGCAAAGAAGACGATGGACCAGTCGGATCTGCCTGGCGAATTGGAGCGGGCCGAAGGCGAA
GGCAAGGTCAAGGACGAAGACGTCAACTTTGCTTACGACAATGTCGGCCTCGTCGTCGACTTTTACAAGAAGCAA
TTCCAGTGGAAGTCGATTGACAACAAGAACGCCGATATCATTAGCTCCGTTCACTTTGGAAAGCAATTTGAAAAT
GCTTTCTGGGACCCCGAGCAGAGGCAGATGGTGTTTGGCGACGGAGGCGAGTTTCTCGGCCACTTCACCAGCTGC
ATCGACGTCATCGGCCACGAGCTCACTCACGCCATCACGGAGCACACCAGTCCCCTCCAGTACTCGGGTCAGCCG
GGCGCGCTCAACGAGCACATCTCGGACGTCTTTGGCATCATGGTCAAGCAGTCGGCCGAGAAGGAAAAAGCGGAC
GAGGCGGACTGGCTCGTGGGTGAAGGATGTTTGCTGCCCGGCGTCAAGGGGACGGCATTGCGAAGCATGAAGAAT
CCCGGGACGGCTTACAACGACCCTCGTTTGGGTAAAGACCCGCAGGTTGACAACATGAGCGAGTACGAGACGACG
TTTGAGGACAATGGAGGCGTGCACATCTACTCGGGCATCCCCAACAAGGCGTTTTACCTGGCGGCCGTGGCCTTT
GGCGGCTACTCTTGGGAGAAGGCGGGCCAGATCTGGTGGAAGGCCATGACGAGCGGACGGGTGCCTTCGCGGTGC
ACCTTTCAGCAGTTTGCCGACGTGACGGTGGAGTGTGCGACGGACGAGTTTGGCGAGGAGGCGGGAAAGAAGGTG
CGCAAGGCGTGGGACAAGGTGGGCGTGACGCGCAAGGTCTAG
Gene >Ophcf2|01497
ATGCCTTGCCCCTGCTTCATCGTTCCGCCTCACCTCCTCCGCAGCATCGCCGAGTCGACCAGCAACCCTCAGCAT
GTCCGTCAAGCTGCTCAGGCCTCGCTCGTCTCTACGGATCGAGTCAAAGTCGGTCGGCAGGATCTCATGTCCCAG
CTGGCGGATCCCACGGCCCGGCGCGATTGCCGACCTGCTCCCTTTATCCCCGAGGCGGTCCTCGCCAGACTCTCA
GCTTCCGAGGGTGTAGACGAACATGTTCGCGAGCAGGCCAAGAGAGACTTGGACCATCTTCAGGCCTTTATTGCC
AAGCCTCTGGCTGAGCAGCAGGGTAAGTGAATCTCTGGACGGAGGCGTCTTTGCTGATGCTGAGATGTTTGAGTA
GCCAGCTTGGCCGCCGCCGAGGACGACAAGAAGAAGCACAAGGGCAACCCCTATCGTGCCGTGTACGACGCAAAG
AAGACGATGGACCAGTCGGATCTGCCTGGCGAATTGGAGCGGGCCGAAGGCGAAGGCAAGGTCAAGGACGAAGAC
GTCAACTTTGCTTACGACAATGTCGGCCTCGTCGTCGACTTTTACAAGAAGCAATTCCAGTGGAAGTCGATTGAC
AACAAGAACGCCGATATCATTAGCTCCGTTCACTTTGGAAAGCAATTTGAAAATGCTTGTAAGTGTCGGACGTCG
CCTAGGCGGAAACGAAGAGCTGATGATGGACCGGATCAGTCTGGGACCCCGAGCAGAGGCAGATGGTGTTTGGCG
ACGGAGGCGAGTTTCTCGGCCACTTCACCAGCTGCATCGACGTCATCGGCCACGAGCTCACTCACGCCATCACGG
AGCACACCAGTCCCCTCCAGTACTCGGGTCAGCCGGGCGCGCTCAACGAGCACATCTCGGACGTCTTTGGCATCA
TGGTCAAGCAGTCGGCCGAGAAGGAAAAAGCGGACGAGGCGGACTGGCTCGTGGGTGAAGGATGTTTGCTGCCCG
GCGTCAAGGGGACGGCATTGCGAAGCATGAAGAATCCCGGGACGGCTTACAACGACCCTCGTTTGGTGAGTGACG
GGGGCAAAGCTCGCAGGCAGACGGCGACTAACGAGGATGAAATTCACAGGGTAAAGACCCGCAGGTTGACAACAT
GAGCGAGTACGAGACGACGTTTGAGGACAATGGAGGCGTGCACATCTACTCGGGCATCCCCAACAAGGCGTTTTA
CCTGGCGGCCGTGGCCTTTGGCGGCTACTCTTGGGAGAAGGCGGGCCAGATCTGGTGGAAGGCCATGACGAGCGG
ACGGGTGCCTTCGCGGTGCACCTTTCAGCAGTTTGCCGACGTGACGGTGGAGTGTGCGACGGACGAGTTTGGCGA
GGAGGCGGGAAAGAAGGTGCGCAAGGCGTGGGACAAGGTGGGCGTGACGCGCAAGGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail