Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01495
Gene name
Locationscaffold_01:5154708..5155554
Strand-
Gene length (bp)846
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04502 Saf4_Yju2 Saf4/Yju2 protein 2.1E-42 33 255

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0006397 mRNA processing No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0008380 RNA splicing No
GO:0090304 nucleic acid metabolic process No
GO:0016071 mRNA metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4627 0.8011 0.0445 0.0264 0.104 0.0087 0.0565 0.1342 0.0557 0.0038

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 36.07 17.21 54.93
Alive In ants, during behavior modification 37.71 17.34 58.09
Dead In ants, recently dead 33.36 15.47 51.26

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.883915 no
Alive Dead 0.598336 no
Dead Fungus 0.782519 no

Orthologs

Orthofinder run ID4
Orthogroup6821
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6013
Ophiocordyceps australis map64 (Brazil) OphauB2|1817
Ophiocordyceps camponoti-floridani Ophcf2|01495 (this protein)
Ophiocordyceps kimflemingae Ophio5|3561

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01495
MQGFNMGRYHPSPPLPPSNPPPPPPPPPPNSPFRTPLPVWCATCPRPTIIAQGVRFNAEKRRVGAYHSTPLWSFT
FRHAQCGGVVEVRTDPRNTAYLVVSGGTKRDTGDDDGGSLLRNANSSEGDRSAAFAKLETTIEHRAQLNMSNHRI
TSLINHSARHWQDPYKANQNLRSAFRPARLKRQQEAQSGAHLGHALSLPFDLPPPTRQDAHHASTITFTPETTKD
EDASRNRSFAPRRRNNNNNNNNNNNNNNNNNNNNNPPAQLSPPSSPPAPASPTIPS*
Coding >Ophcf2|01495
ATGCAGGGCTTCAACATGGGCCGCTACCACCCCTCCCCCCCTCTCCCCCCCTCAAACCCCCCCCCCCCACCGCCG
CCGCCGCCCCCCAACAGTCCGTTTCGAACTCCCCTTCCCGTCTGGTGCGCGACCTGTCCGCGTCCCACGATAATA
GCCCAAGGCGTGCGCTTCAACGCCGAGAAGCGCCGCGTCGGAGCCTACCATTCCACTCCGCTATGGAGCTTCACT
TTCCGTCACGCCCAGTGCGGCGGTGTCGTCGAGGTGCGCACCGATCCGCGGAACACGGCCTACCTTGTCGTCAGC
GGCGGCACGAAGCGCGATACCGGCGACGATGATGGTGGTTCTCTTCTTCGCAATGCAAACTCCTCAGAGGGGGAT
CGAAGCGCCGCCTTTGCCAAGCTAGAGACCACCATCGAACACAGAGCCCAACTCAACATGTCAAACCATCGCATC
ACTTCCCTAATCAACCACTCCGCCCGCCACTGGCAAGACCCCTACAAAGCCAACCAAAATCTCCGATCCGCCTTC
CGCCCAGCCCGCCTCAAAAGACAACAAGAAGCCCAATCGGGAGCCCACCTCGGCCACGCCCTCTCCCTCCCCTTC
GACCTCCCCCCCCCCACAAGACAAGACGCCCACCACGCCTCGACCATAACCTTCACCCCCGAAACAACAAAAGAC
GAGGATGCCTCTCGCAACCGCTCTTTCGCTCCACGCCGCAGAAACAACAACAACAACAACAACAACAACAACAAC
AACAACAACAACAACAACAACAACAACAACCCGCCCGCCCAGCTCTCGCCTCCCAGCTCGCCGCCAGCTCCCGCC
TCGCCCACGATCCCTTCCTGA
Transcript >Ophcf2|01495
ATGCAGGGCTTCAACATGGGCCGCTACCACCCCTCCCCCCCTCTCCCCCCCTCAAACCCCCCCCCCCCACCGCCG
CCGCCGCCCCCCAACAGTCCGTTTCGAACTCCCCTTCCCGTCTGGTGCGCGACCTGTCCGCGTCCCACGATAATA
GCCCAAGGCGTGCGCTTCAACGCCGAGAAGCGCCGCGTCGGAGCCTACCATTCCACTCCGCTATGGAGCTTCACT
TTCCGTCACGCCCAGTGCGGCGGTGTCGTCGAGGTGCGCACCGATCCGCGGAACACGGCCTACCTTGTCGTCAGC
GGCGGCACGAAGCGCGATACCGGCGACGATGATGGTGGTTCTCTTCTTCGCAATGCAAACTCCTCAGAGGGGGAT
CGAAGCGCCGCCTTTGCCAAGCTAGAGACCACCATCGAACACAGAGCCCAACTCAACATGTCAAACCATCGCATC
ACTTCCCTAATCAACCACTCCGCCCGCCACTGGCAAGACCCCTACAAAGCCAACCAAAATCTCCGATCCGCCTTC
CGCCCAGCCCGCCTCAAAAGACAACAAGAAGCCCAATCGGGAGCCCACCTCGGCCACGCCCTCTCCCTCCCCTTC
GACCTCCCCCCCCCCACAAGACAAGACGCCCACCACGCCTCGACCATAACCTTCACCCCCGAAACAACAAAAGAC
GAGGATGCCTCTCGCAACCGCTCTTTCGCTCCACGCCGCAGAAACAACAACAACAACAACAACAACAACAACAAC
AACAACAACAACAACAACAACAACAACAACCCGCCCGCCCAGCTCTCGCCTCCCAGCTCGCCGCCAGCTCCCGCC
TCGCCCACGATCCCTTCCTGA
Gene >Ophcf2|01495
ATGCAGGGCTTCAACATGGGCCGCTACCACCCCTCCCCCCCTCTCCCCCCCTCAAACCCCCCCCCCCCACCGCCG
CCGCCGCCCCCCAACAGTCCGTTTCGAACTCCCCTTCCCGTCTGGTGCGCGACCTGTCCGCGTCCCACGATAATA
GCCCAAGGCGTGCGCTTCAACGCCGAGAAGCGCCGCGTCGGAGCCTACCATTCCACTCCGCTATGGAGCTTCACT
TTCCGTCACGCCCAGTGCGGCGGTGTCGTCGAGGTGCGCACCGATCCGCGGAACACGGCCTACCTTGTCGTCAGC
GGCGGCACGAAGCGCGATACCGGCGACGATGATGGTGGTTCTCTTCTTCGCAATGCAAACTCCTCAGAGGGGGAT
CGAAGCGCCGCCTTTGCCAAGCTAGAGACCACCATCGAACACAGAGCCCAACTCAACATGTCAAACCATCGCATC
ACTTCCCTAATCAACCACTCCGCCCGCCACTGGCAAGACCCCTACAAAGCCAACCAAAATCTCCGATCCGCCTTC
CGCCCAGCCCGCCTCAAAAGACAACAAGAAGCCCAATCGGGAGCCCACCTCGGCCACGCCCTCTCCCTCCCCTTC
GACCTCCCCCCCCCCACAAGACAAGACGCCCACCACGCCTCGACCATAACCTTCACCCCCGAAACAACAAAAGAC
GAGGATGCCTCTCGCAACCGCTCTTTCGCTCCACGCCGCAGAAACAACAACAACAACAACAACAACAACAACAAC
AACAACAACAACAACAACAACAACAACAACCCGCCCGCCCAGCTCTCGCCTCCCAGCTCGCCGCCAGCTCCCGCC
TCGCCCACGATCCCTTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail